Protein detail

SIGL6

Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)

Entry name SIGL6	UniProt ID O43699	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count 1	Protein classification CD markersPredicted membrane proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Sialic acid-binding Ig-like lectin 6 (Siglec-6) (CD33 antigen-like 1) (CDw327) (Obesity-binding protein 1) (OB-BP1) (CD antigen CD327)

Protein Class (3)

CD markersPredicted membrane proteinsPredicted secreted proteins

Protein Function (2)

Predicted secreted proteins
CD markers

Transmembrane

348..368; Helical

Transmembrane Count

Ensembl

ENSG00000105492

Entrez Gene Symbol

SIGLEC6

Gene Synonym (5)

CD327CD33LCD33L1OB-BP1SIGLEC-6

Gene Description

Sialic acid binding Ig like lectin 6

Chromosome

Position

51517819-51531856

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization4

Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specifichippocampal CA4Blood Cell Specificbasophil

Function & Pathway7

Protein Function (2)

Predicted secreted proteins
CD markers

Cellular Component (4)

Molecular Function (3)

Biological Process (3)

Reactome (2)

Canonical Pathways

M7 Pid fcer1 pathway

Mediation Categories

Immune mediation

Relations & Evidence30

Ligand-Receptor Signaling (29)

29 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
secreted	secreted	UniProt_keyword	No	No	Yes	Yes	No
secreted	secreted	UniProt_location	No	No	Yes	Yes	No
secreted	secreted	OmniPath	No	No	Yes	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	Yes	Yes	No
cell_surface	cell_surface	OmniPath	No	No	Yes	Yes	No
receptor	receptor	Cellinker	No	Yes	Yes	Yes	No
sialic_acid_binding_lectin	receptor	HGNC	No	Yes	Yes	Yes	No
receptor	receptor	HGNC	No	Yes	Yes	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	Yes	Yes	No

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Western blotting	3	38731868 40098346 37922300

Sequence, Structure & Domains10

Sequences

Length

453

Mass

49,913

Sequence

MQGAQEASASEMLPLLLPLLWAGALAQERRFQLEGPESLTVQEGLCVLVPCRLPTTLPASYYGYGYWFLEGADVPVATNDPDEEVQEETRGRFHLLWDPRRKNCSLSIRDARRRDNAAYFFRLKSKWMKYGYTSSKLSVRVMALTHRPNISIPGTLESGHPSNLTCSVPWVCEQGTPPIFSWMSAAPTSLGPRTTQSSVLTITPRPQDHSTNLTCQVTFPGAGVTMERTIQLNVSYAPQKVAISIFQGNSAAFKILQNTSSLPVLEGQALRLLCDADGNPPAHLSWFQGFPALNATPISNTGVLELPQVGSAEEGDFTCRAQHPLGSLQISLSLFVHWKPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Alternative Products

Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=Membrane-bound, CD33L1; IsoId=O43699-1; Sequence=Displayed; Name=2; Synonyms=Secreted, CD33L2; IsoId=O43699-2; Sequence=VSP_002553, VSP_002554; Name=3; IsoId=O43699-3; Sequence=VSP_035812; Name=4; IsoId=O43699-4; Sequence=VSP_035811, VSP_002553, VSP_002554; Name=5; IsoId=O43699-5; Sequence=VSP_045387, VSP_045388; Name=6; IsoId=O43699-6; Sequence=VSP_046070, VSP_035812

Alternative Sequence

23..58; Missing (in isoform 6); 143..153; Missing (in isoform 4); 236..252; YAPQKVAISIFQGNSAA -> S (in isoform 3 and isoform 6); 236; Y -> WMLRRPPLSTPD (in isoform 5); 339..391; KPEGRAGGVLGAVWGASITTLVFLCVCFIFRVKTRRKKAAQPVQNTDDVNPVM -> SSAPVPDRHSFRPPC (in isoform 2 and isoform 4); 371..453; KTRRKKAAQPVQNTDDVNPVMVSGSRGHQHQFQTGIVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK -> ISTSSRQA (in isoform 5); 392..453; Missing (in isoform 2 and isoform 4)

Domain & Motif Annotations

Motif

424..429; ITIM motif; 444..449; SLAM-like motif

Domain (CC)

Contains 1 copy of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.

Domain (FT)

28..123; Ig-like V-type; 148..231; Ig-like C2-type 1; 238..333; Ig-like C2-type 2

Protein Families (2)

Immunoglobulin superfamily
SIGLEC (sialic acid binding Ig-like lectin) family

Sequence Similarities

Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.

Clinical Relevance1

Antibody (3)

HPA008945 HPA009084 HPA018198

Supporting Publications1

PMID	Title	Abstract
37713494	ATP1A3 as a target for isolating neuron-specific extracellular vesicles from human brain and biofluids.	No abstract available