Protein detail
DOK2
Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))
Entry name DOK2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 6 | Transmembrane count | Protein classification Predicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
Dok-2p56dok-2
Gene Description
Docking protein 2
Chromosome
8
Position
21908873-21913690
Supporting publications (n)
6
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificbrainBrain Regional SpecificcerebellumCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Reactome (5)
Mediation Categories (2)
Immune mediationReceptor-signaling mediation
Relations & Evidence21
Enzyme-Mediated Modification (13)
13 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| DOK2 | PTPRG | P23470 | Y | 139 | dephosphorylation | SIGNOR | SIGNOR:25624455 |
| DOK2 | PTPRG | P23470 | Y | 139 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:25624455 |
| DOK2 | LYN | P07948 | Y | 271 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862 |
| DOK2 | LYN | P07948 | Y | 299 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862HPRD:19901323HPRD:16497976 |
| DOK2 | LYN | P07948 | Y | 345 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862 |
| DOK2 | HCK | P08631 | Y | 271 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862 |
| DOK2 | HCK | P08631 | Y | 299 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862HPRD:19901323HPRD:16497976 |
| DOK2 | HCK | P08631 | Y | 345 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862 |
| DOK2 | SRC | P12931 | Y | 271 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862KEA:10428862 |
| DOK2 | SRC | P12931 | Y | 299 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA | HPRD:10428862HPRD:16497976KEA:10428862KEA:17570479HPRD:19901323 |
Page 1 of 2Next
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TIE2 | Q02763 | DOK2 | O60496 | Yes | Yes | No | PhosphoPointHPRDSignaLink3BioGRIDWang | SignaLink3:11689432BioGRID:11689432SignaLink3:9764820HPRD:9764820SignaLink3:23331499BioGRID:9764820 |
| PTPRG | P23470 | DOK2 | O60496 | Yes | Yes | No | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:25624455ProtMapper:25624455 |
Protein Complex Composition (2)
2 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| COA7DIS3DOK2EXOSC1EXOSC10EXOSC2EXOSC3EXOSC4EXOSC5EXOSC6MPHOSPH6MTREXRAB10SUPT6H | O60496P42285P61026Q01780Q13868Q5RKV6Q7KZ85Q96BR5Q99547Q9NPD3Q9NQT4Q9NQT5Q9Y2L1Q9Y3B2 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5116 | ||
| DOK2RGPD4 | O60496Q7Z3J3 | 0:0 | hu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31805958 |
Sequence, Structure & Domains12
Sequences
Length
412
Mass
45,379
Sequence
MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK
3D Structural Models
Helix
62..64; 99..113; 159..164; 196..198; 231..247
Beta Strand
5..13; 17..20; 25..31; 34..37; 40..44; 50..52; 57..60; 65..70; 75..77; 82..90; 92..97; 151..155; 168..174; 176..180; 184..187; 202..205; 208..213; 221..226
3D Structure
NMR spectroscopy (2)
Domain & Motif Annotations
Compositional Bias
277..291; Pro residues; 361..378; Basic and acidic residues
Domain (CC)
PTB domain mediates receptor interaction.
Domain (FT)
4..114; PH; 147..252; IRS-type PTB
Region
246..296; Disordered; 359..412; Disordered
Protein Families (2)
- DOK family
- Type A subfamily
Sequence Similarities
Belongs to the DOK family. Type A subfamily.
Clinical Relevance4
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No abstract available |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No abstract available |
| 35294531 | Identification of CD14 and lipopolysaccharide-binding protein as novel biomarkers for sarcoidosis using proteomics of serum extracellular vesicles. | No abstract available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No abstract available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No abstract available |
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No abstract available |