Protein detail

DOK2

Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))

Entry name DOK2	UniProt ID O60496	EVMP confidence score 0.50
Supporting publications (n) 6	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Docking protein 2 (Downstream of tyrosine kinase 2) (p56(dok-2))

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000147443

Entrez Gene Symbol

DOK2

Gene Synonym (2)

Dok-2p56dok-2

Gene Description

Docking protein 2

Chromosome

Position

21908873-21913690

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization5

Tissue SpecificbrainBrain Regional SpecificcerebellumCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificupper rhombic lip

Function & Pathway7

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

KEGG

hsa04517 IgSF CAM signaling

Reactome (5)

Mediation Categories (2)

Immune mediationReceptor-signaling mediation

Relations & Evidence21

Enzyme-Mediated Modification (13)

13 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
DOK2	SRC	P12931	Y	345	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPHPRDKEA	HPRD:10428862 KEA:10428862
DOK2	EGFR	P00533	Y	402	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:15831486
DOK2	BTK	Q06187	Y	299	phosphorylation	KEA	KEA:17570479

Page 2 of 2Previous

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
TIE2	Q02763	DOK2	O60496	Yes	Yes	No	PhosphoPointHPRDSignaLink3BioGRIDWang	SignaLink3:11689432 BioGRID:11689432 SignaLink3:9764820 HPRD:9764820 SignaLink3:23331499 BioGRID:9764820
PTPRG	P23470	DOK2	O60496	Yes	Yes	No	SIGNOR_ProtMapperSIGNORProtMapper	SIGNOR:25624455 ProtMapper:25624455

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	COA7 DIS3 DOK2 EXOSC1 EXOSC10 EXOSC2 EXOSC3 EXOSC4 EXOSC5 EXOSC6 MPHOSPH6 MTREX RAB10 SUPT6H	O60496 P42285 P61026 Q01780 Q13868 Q5RKV6 Q7KZ85 Q96BR5 Q99547 Q9NPD3 Q9NQT4 Q9NQT5 Q9Y2L1 Q9Y3B2	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5116
	DOK2 RGPD4	O60496 Q7Z3J3	0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	31805958

Sequence, Structure & Domains12

Sequences

Length

412

Mass

45,379

Sequence

MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKPRRCEAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAAERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKEFAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLRRFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAPATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYAVPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEGVAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGTEYDNVVLKKGPK

3D Structural Models

Helix

62..64; 99..113; 159..164; 196..198; 231..247

Beta Strand

5..13; 17..20; 25..31; 34..37; 40..44; 50..52; 57..60; 65..70; 75..77; 82..90; 92..97; 151..155; 168..174; 176..180; 184..187; 202..205; 208..213; 221..226

3D Structure

NMR spectroscopy (2)

Domain & Motif Annotations

Compositional Bias

277..291; Pro residues; 361..378; Basic and acidic residues

Domain (CC)

PTB domain mediates receptor interaction.

Domain (FT)

4..114; PH; 147..252; IRS-type PTB

Region

246..296; Disordered; 359..412; Disordered

Protein Families (2)

DOK family
Type A subfamily

Sequence Similarities

Belongs to the DOK family. Type A subfamily.

Clinical Relevance4

Antibody (4)

HPA002862 CAB004379 HPA066571 HPA069121

Interaction Protein

ENSG00000182866

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications6

PMID	Title	Abstract
29148239	Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants.	No abstract available
33204424	Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid.	No abstract available
35294531	Identification of CD14 and lipopolysaccharide-binding protein as novel biomarkers for sarcoidosis using proteomics of serum extracellular vesicles.	No abstract available
36398564	Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles.	No abstract available
39766158	A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis.	No abstract available
39940923	NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles.	No abstract available