Protein detail
CUTA
Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)
Entry name CUTA | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 13 | Transmembrane count | Protein classification Predicted intracellular proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)
Protein Class (2)
Predicted intracellular proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ACHAPC6orf82
Gene Description
CutA divalent cation tolerance homolog
Chromosome
6
Position
33416442-33418317
Supporting publications (n)
13
EVMP confidence score
0.60
Fluorescence & Localization2
Cell SpecificEarly primary spermatocytes
Function & Pathway6
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Canonical Pathways
M276 Pid fgf pathway
Mediation Categories
Other mediation
Relations & Evidence19
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | Yes | No | No |
| transmembrane | transmembrane | TopDB | No | No | Yes | No | No |
| transmembrane | transmembrane | LOCATE | No | No | Yes | No | No |
| transmembrane | transmembrane | OmniPath | No | No | Yes | No | No |
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | Yes | No | No |
Page 1 of 2Next
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CUTA | O60888 | 6 | PDB | PDB:1xk8PDB:2zfh | ||
| ACSL5CUTAECHS1HADHHSD17B10UPP1 | O60888P30084Q16831Q16836Q99714Q9ULC5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CUTAUPP1 | O60888Q16831 | 0:0 | hu.MAP2 | |||
| ACSL5CUTAHADHHSD17B10PGM2L1UPP1 | O60888Q16831Q16836Q6PCE3Q99714Q9ULC5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CUTAPGM2L1UPP1 | O60888Q16831Q6PCE3 | 0:0:0 | hu.MAP2 | |||
| CDK19CUTAFKBP15GPN1MYEF2 | O60888Q5T1M5Q9BWU1Q9HCN4Q9P2K5 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_466 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31805958 |
Sequence, Structure & Domains11
Sequences
Length
179
Mass
19,116
Sequence
MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=B; IsoId=O60888-1; Sequence=Displayed; Name=A; IsoId=O60888-2; Sequence=VSP_013225; Name=C; IsoId=O60888-3; Sequence=VSP_013226
Alternative Sequence
1..23; Missing (in isoform C); 1..14; MSGGRAPAVLLGGV -> MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ (in isoform A)
3D Structural Models
Helix
78..90; 127..129; 130..140; 158..166
Beta Strand
67..77; 95..109; 112..126; 142..145; 148..153
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Region
168..176; O-glycosylated at one site
Protein Families
CutA family
Sequence Similarities
Belongs to the CutA family.
Clinical Relevance4
Supporting Publications13
| PMID | Title | Abstract |
|---|---|---|
| 31617158 | Proteomic profiling of peritoneal dialysis effluent-derived extracellular vesicles: a longitudinal study. | No abstract available |
| 31805958 | Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment. | No abstract available |
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33304478 | The proteomic landscape of small urinary extracellular vesicles during kidney transplantation. | No abstract available |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No abstract available |
| 34599510 | Inflammatory capacity of exosomes released in the early stages of acute pancreatitis predicts the severity of the disease. | In particular, an increase in the amount of S100A8 and S100A9 carried by exosomes of severe pancreatitis suggests that the mechanism of action of exosomes is mediated by the effect of these proteins on NADPH oxidase. |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No abstract available |
| 38891077 | Altered Extracellular Vesicle-Derived Protein and microRNA Signatures in Bronchoalveolar Lavage Fluid from Patients with Chronic Obstructive Pulmonary Disease. | No abstract available |
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No abstract available |
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No abstract available |
Page 1 of 2Next