Protein detail

CUTA

Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)

Entry name CUTA	UniProt ID O60888	EVMP confidence score 0.60
Supporting publications (n) 13	Transmembrane count	Protein classification Predicted intracellular proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)

Protein Class (2)

Predicted intracellular proteinsPredicted secreted proteins

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Ensembl

ENSG00000112514

Entrez Gene Symbol

CUTA

Gene Synonym (2)

ACHAPC6orf82

Gene Description

CutA divalent cation tolerance homolog

Chromosome

Position

33416442-33418317

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization2

Cell SpecificEarly primary spermatocytes

Function & Pathway6

Protein Function (2)

Predicted secreted proteins
Predicted intracellular proteins

Cellular Component (3)

Molecular Function (3)

Biological Process (3)

Canonical Pathways

M276 Pid fgf pathway

Mediation Categories

Other mediation

Relations & Evidence19

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane_phobius	transmembrane_predicted	Almen2009	No	No	Yes	No	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	Yes	No	No

Page 2 of 2Previous

Protein Complex Composition (6)

6 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CUTA	O60888	6	PDB	PDB:1xk8PDB:2zfh
ACSL5 CUTA ECHS1 HADH HSD17B10 UPP1	O60888 P30084 Q16831 Q16836 Q99714 Q9ULC5	0:0:0:0:0:0	hu.MAP2
CUTA UPP1	O60888 Q16831	0:0	hu.MAP2
ACSL5 CUTA HADH HSD17B10 PGM2L1 UPP1	O60888 Q16831 Q16836 Q6PCE3 Q99714 Q9ULC5	0:0:0:0:0:0	hu.MAP2
CUTA PGM2L1 UPP1	O60888 Q16831 Q6PCE3	0:0:0	hu.MAP2
CDK19 CUTA FKBP15 GPN1 MYEF2	O60888 Q5T1M5 Q9BWU1 Q9HCN4 Q9P2K5	0:0:0:0:0	Havugimana2012	Havugimana2012:C_466

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	31805958

Sequence, Structure & Domains11

Sequences

Length

179

Mass

19,116

Sequence

MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=B; IsoId=O60888-1; Sequence=Displayed; Name=A; IsoId=O60888-2; Sequence=VSP_013225; Name=C; IsoId=O60888-3; Sequence=VSP_013226

Alternative Sequence

1..23; Missing (in isoform C); 1..14; MSGGRAPAVLLGGV -> MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ (in isoform A)

3D Structural Models

Helix

78..90; 127..129; 130..140; 158..166

Beta Strand

67..77; 95..109; 112..126; 142..145; 148..153

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Region

168..176; O-glycosylated at one site

Protein Families

CutA family

Sequence Similarities

Belongs to the CutA family.

Clinical Relevance4

Antibody (3)

CAB016787 HPA064369 HPA070199

Interaction Protein

ENSG00000162458

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications13

PMID	Title	Abstract
31617158	Proteomic profiling of peritoneal dialysis effluent-derived extracellular vesicles: a longitudinal study.	No abstract available
31805958	Proteomic analysis of cerebrospinal fluid extracellular vesicles reveals synaptic injury, inflammation, and stress response markers in HIV patients with cognitive impairment.	No abstract available
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
33304478	The proteomic landscape of small urinary extracellular vesicles during kidney transplantation.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available
34599510	Inflammatory capacity of exosomes released in the early stages of acute pancreatitis predicts the severity of the disease.	In particular, an increase in the amount of S100A8 and S100A9 carried by exosomes of severe pancreatitis suggests that the mechanism of action of exosomes is mediated by the effect of these proteins on NADPH oxidase.
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38891077	Altered Extracellular Vesicle-Derived Protein and microRNA Signatures in Bronchoalveolar Lavage Fluid from Patients with Chronic Obstructive Pulmonary Disease.	No abstract available
39001700	Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles.	No abstract available
39207047	The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis.	No abstract available

Page 1 of 2Next