Protein detail
CUTA
Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)
Entry name CUTA | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 13 | Transmembrane count | Protein classification Predicted intracellular proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Protein CutA (Acetylcholinesterase-associated protein) (Brain acetylcholinesterase putative membrane anchor)
Protein Class (2)
Predicted intracellular proteinsPredicted secreted proteins
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
ACHAPC6orf82
Gene Description
CutA divalent cation tolerance homolog
Chromosome
6
Position
33416442-33418317
Supporting publications (n)
13
EVMP confidence score
0.60
Fluorescence & Localization2
Cell SpecificEarly primary spermatocytes
Function & Pathway6
Protein Function (2)
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (3)
Biological Process (3)
Canonical Pathways
M276 Pid fgf pathway
Mediation Categories
Other mediation
Relations & Evidence19
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | Yes | No | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | Yes | No | No |
Page 2 of 2Previous
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CUTA | O60888 | 6 | PDB | PDB:1xk8PDB:2zfh | ||
| ACSL5CUTAECHS1HADHHSD17B10UPP1 | O60888P30084Q16831Q16836Q99714Q9ULC5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CUTAUPP1 | O60888Q16831 | 0:0 | hu.MAP2 | |||
| ACSL5CUTAHADHHSD17B10PGM2L1UPP1 | O60888Q16831Q16836Q6PCE3Q99714Q9ULC5 | 0:0:0:0:0:0 | hu.MAP2 | |||
| CUTAPGM2L1UPP1 | O60888Q16831Q6PCE3 | 0:0:0 | hu.MAP2 | |||
| CDK19CUTAFKBP15GPN1MYEF2 | O60888Q5T1M5Q9BWU1Q9HCN4Q9P2K5 | 0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_466 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 31805958 |
Sequence, Structure & Domains11
Sequences
Length
179
Mass
19,116
Sequence
MSGGRAPAVLLGGVASLLLSFVWMPALLPVASRLLLLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVLMMIKTQSSLVPALTDFVRSVHPYEVAEVIALPVEQGNFPYLQWVRQVTESVSDSITVLP
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=B; IsoId=O60888-1; Sequence=Displayed; Name=A; IsoId=O60888-2; Sequence=VSP_013225; Name=C; IsoId=O60888-3; Sequence=VSP_013226
Alternative Sequence
1..23; Missing (in isoform C); 1..14; MSGGRAPAVLLGGV -> MIGSGLAGSGGAGGPSSTVTWCALFSNHVAATQ (in isoform A)
3D Structural Models
Helix
78..90; 127..129; 130..140; 158..166
Beta Strand
67..77; 95..109; 112..126; 142..145; 148..153
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Region
168..176; O-glycosylated at one site
Protein Families
CutA family
Sequence Similarities
Belongs to the CutA family.
Clinical Relevance4
Supporting Publications13
| PMID | Title | Abstract |
|---|---|---|
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No abstract available |
| 41128489 | Multiparametric Bulk and Single Extracellular Vesicle Pipeline for Identifying Adipose-Specific Signatures in Matched Human Biospecimens. | No abstract available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No abstract available |
Page 2 of 2Previous