Protein detail
PFD1
Prefoldin subunit 1
Entry name PFD1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 43 | Transmembrane count | Protein classification Essential proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Prefoldin subunit 1
Protein Class (3)
Essential proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PFD1
Gene Description
Prefoldin subunit 1
Chromosome
5
Position
140245035-140303113
Supporting publications (n)
43
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecificbrainCell SpecificEndometrial luminal cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence14
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 28986585 |
Sequence, Structure & Domains
Sequences
Length
122
Mass
14,210
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
3D Structural Models
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Protein Families
Prefoldin subunit beta family
Sequence Similarities
Belongs to the prefoldin subunit beta family.
Clinical Relevance
Antibody
Interaction Protein (11)
ENSG00000101132ENSG00000108262ENSG00000123349ENSG00000131653ENSG00000132305ENSG00000140395ENSG00000140854ENSG00000143256ENSG00000155959ENSG00000172354ENSG00000204220
Interaction Count
11
Interaction Dataset (4)
biogrid_bioplexintact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplex
Supporting Publications43
| PMID | Title | Related sentences |
|---|---|---|
| 26801919 | Exosomes Secreted by Apoptosis-Resistant Acute Myeloid Leukemia (AML) Blasts Harbor Regulatory Network Proteins Potentially Involved in Antagonism of Apoptosis. | No related sentences available |
| 26884841 | Exosomes mediated pentose phosphate pathway in ovarian cancer metastasis: a proteomics analysis. | No related sentences available |
| 27312428 | A novel TP53 pathway influences the HGS-mediated exosome formation in colorectal cancer. | No related sentences available |
| 27723984 | Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection. | No related sentences available |
| 27863537 | High-resolution proteomic and lipidomic analysis of exosomes and microvesicles from different cell sources. | No related sentences available |
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No related sentences available |
| 30071318 | Changes in the urinary extracellular vesicle proteome are associated with nephronophthisis-related ciliopathies. | No related sentences available |
| 30608700 | Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs. | No related sentences available |
Page 1 of 5Next