Protein detail
PFD1
Prefoldin subunit 1
Entry name PFD1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 43 | Transmembrane count | Protein classification Essential proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Prefoldin subunit 1
Protein Class (3)
Essential proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PFD1
Gene Description
Prefoldin subunit 1
Chromosome
5
Position
140245035-140303113
Supporting publications (n)
43
EVMP confidence score
0.75
Fluorescence & Localization2
Tissue SpecificbrainCell SpecificEndometrial luminal cells
Function & Pathway6
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence14
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 28986585 |
Sequence, Structure & Domains6
Sequences
Length
122
Mass
14,210
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
3D Structural Models
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Protein Families
Prefoldin subunit beta family
Sequence Similarities
Belongs to the prefoldin subunit beta family.
Clinical Relevance4
Antibody
Interaction Protein (11)
ENSG00000101132ENSG00000108262ENSG00000123349ENSG00000131653ENSG00000132305ENSG00000140395ENSG00000140854ENSG00000143256ENSG00000155959ENSG00000172354ENSG00000204220
Interaction Count
11
Interaction Dataset (4)
biogrid_bioplexintact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplex
Supporting Publications43
| PMID | Title | Abstract |
|---|---|---|
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No abstract available |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 31196968 | Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway. | No abstract available |
| 31320591 | Exosomes regulate neurogenesis and circuit assembly. | No abstract available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No abstract available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No abstract available |
| 33114768 | Proteomic Profiling of Two Distinct Populations of Extracellular Vesicles Isolated from Human Seminal Plasma. | No abstract available |