Protein detail
PFD1
Prefoldin subunit 1
Entry name PFD1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 43 | Transmembrane count | Protein classification Essential proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Prefoldin subunit 1
Protein Class (3)
Essential proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PFD1
Gene Description
Prefoldin subunit 1
Chromosome
5
Position
140245035-140303113
Supporting publications (n)
43
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecificbrainCell SpecificEndometrial luminal cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence14
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 28986585 |
Sequence, Structure & Domains
Sequences
Length
122
Mass
14,210
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
3D Structural Models
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Protein Families
Prefoldin subunit beta family
Sequence Similarities
Belongs to the prefoldin subunit beta family.
Clinical Relevance
Antibody
Interaction Protein (11)
ENSG00000101132ENSG00000108262ENSG00000123349ENSG00000131653ENSG00000132305ENSG00000140395ENSG00000140854ENSG00000143256ENSG00000155959ENSG00000172354ENSG00000204220
Interaction Count
11
Interaction Dataset (4)
biogrid_bioplexintact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplex
Supporting Publications43
| PMID | Title | Related sentences |
|---|---|---|
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 33718342 | Extracellular Vesicles Derived From Adult and Fetal Bone Marrow Mesenchymal Stromal Cells Differentially Promote ex vivo Expansion of Hematopoietic Stem and Progenitor Cells. | No related sentences available |
| 34108659 | Quantitative proteomics identifies the core proteome of exosomes with syntenin-1 as the highest abundant protein and a putative universal biomarker. | Syntenin-1 is also present in exosomes across different species and biofluids, highlighting its potential use as a putative universal biomarker of exosomes. We identified syntenin-1 as a consistently abundant protein in exosomes from different cellular origins. |
| 34622320 | A possible role of gas-phase electrophoretic mobility molecular analysis (nES GEMMA) in extracellular vesicle research. | No related sentences available |
| 35194965 | Muscle cells of sporadic amyotrophic lateral sclerosis patients secrete neurotoxic vesicles. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No related sentences available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No related sentences available |
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |