Protein detail
PFD1
Prefoldin subunit 1
Entry name PFD1 | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 43 | Transmembrane count | Protein classification Essential proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Prefoldin subunit 1
Protein Class (3)
Essential proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
PFD1
Gene Description
Prefoldin subunit 1
Chromosome
5
Position
140245035-140303113
Supporting publications (n)
43
EVMP confidence score
0.75
Fluorescence & Localization
Tissue SpecificbrainCell SpecificEndometrial luminal cells
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (2)
Molecular Function (4)
Biological Process (3)
Reactome (2)
Mediation Categories
Metabolism mediation
Relations & Evidence14
Ligand-Receptor Signaling (3)
3 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 28986585 |
Sequence, Structure & Domains
Sequences
Length
122
Mass
14,210
Sequence
MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ
3D Structural Models
3D Structure
Electron microscopy (6)
Domain & Motif Annotations
Protein Families
Prefoldin subunit beta family
Sequence Similarities
Belongs to the prefoldin subunit beta family.
Clinical Relevance
Antibody
Interaction Protein (11)
ENSG00000101132ENSG00000108262ENSG00000123349ENSG00000131653ENSG00000132305ENSG00000140395ENSG00000140854ENSG00000143256ENSG00000155959ENSG00000172354ENSG00000204220
Interaction Count
11
Interaction Dataset (4)
biogrid_bioplexintact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplex
Supporting Publications43
| PMID | Title | Related sentences |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 38644352 | The tumour-derived extracellular vesicle proteome varies by endometrial cancer histology and is confounded by an obesogenic environment. | No related sentences available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No related sentences available |
| 39940641 | Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients. | No related sentences available |
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No related sentences available |
| 40545963 | Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer. | No related sentences available |