Protein detail

PFD1

Prefoldin subunit 1

Entry name PFD1	UniProt ID O60925	EVMP confidence score 0.75
Supporting publications (n) 43	Transmembrane count	Protein classification Essential proteinsPredicted intracellular proteinsPredicted membrane proteins

Basic Information

Protein Names

Prefoldin subunit 1

Protein Class (3)

Essential proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000113068

Entrez Gene Symbol

PFDN1

Gene Synonym

PFD1

Gene Description

Prefoldin subunit 1

Chromosome

Position

140245035-140303113

Supporting publications (n)

EVMP confidence score

0.75

Fluorescence & Localization

Tissue SpecificbrainCell SpecificEndometrial luminal cells

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component (2)

Molecular Function (4)

Biological Process (3)

Reactome (2)

Mediation Categories

Metabolism mediation

Relations & Evidence14

Ligand-Receptor Signaling (3)

3 records.

Category	Parent	Database
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	OmniPath

Protein Complex Composition (10)

10 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Prefoldin co-chaperone	PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 VBP1	O15212 O60925 P61758 Q99471 Q9NQP4 Q9UHV9	1:1:1:1:1:1	SIGNORCORUMComplexPortalCompleathu.MAP2	SIGNOR:SIGNOR-C513Compleat:HC72CORUM:33intact:EBI-25825106	31738558 9463374 12456645 14634002 14755292 32699605
Prefoldin co-chaperone complex	PDRG1 PFDN1 PFDN2 PFDN5 PFDN6 VBP1	O15212 O60925 P61758 Q99471 Q9NUG6 Q9UHV9	1:1:1:1:1:1	ComplexPortal		34761191 14755292 38498526 38532014 32699605
prefoldin complex	PDRG1 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 SLMAP URI1 UXT VBP1	O15212 O60925 O94763 P61758 Q14BN4 Q99471 Q9NQP4 Q9NUG6 Q9UBK9 Q9UHV9	1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC11	9630229
	DNAAF10 MARCHF9 PDRG1 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 PIH1D1 RPAP3 TIPARP URI1 UXT VBP1	O15212 O60925 O94763 P61758 Q7Z3E1 Q86YJ5 Q96MX6 Q99471 Q9H6T3 Q9NQP4 Q9NUG6 Q9NWS0 Q9UBK9 Q9UHV9	0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
	ABL1 NUBP2 PDRG1 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 PPP1R14B VBP1	O15212 O60925 P00519 P61758 Q96C90 Q99471 Q9NQP4 Q9NUG6 Q9UHV9 Q9Y5Y2	0:0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_586
	CCT2 CCT3 CCT4 CCT5 CCT6A CCT7 CCT8 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 TCP1 VBP1	O15212 O60925 P17987 P40227 P48643 P49368 P50990 P50991 P61758 P78371 Q99471 Q99832 Q9NQP4 Q9UHV9	1:1:2:2:2:2:2:2:1:2:1:2:1:1	PDB	PDB:6nr8PDB:6nrbPDB:7wu7PDB:6nrcPDB:6nr9PDB:6nrd
	AOX1 LMNB2 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 VBP1	O15212 O60925 P61758 Q03252 Q06278 Q99471 Q9NQP4 Q9UHV9	0:0:0:0:0:0:0:0	hu.MAP
	MARCHF9 PFDN1 PFDN2 PFDN4 PFDN5 PFDN6 TIPARP VBP1	O15212 O60925 P61758 Q7Z3E1 Q86YJ5 Q99471 Q9NQP4 Q9UHV9	0:0:0:0:0:0:0:0	hu.MAP2
	AOX1 LMNB2 PFDN1 PFDN4 PFDN5 PFDN6	O15212 O60925 Q03252 Q06278 Q99471 Q9NQP4	0:0:0:0:0:0	hu.MAP
	MEF2C MEF2D PFDN1 SNX5 USF2	O60925 Q06413 Q14814 Q15853 Q9Y5X3	1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8682

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	Mass spectrometry	1	28986585

Sequence, Structure & Domains

Sequences

Length

122

Mass

14,210

Sequence

MAAPVDLELKKAFTELQAKVIDTQQKVKLADIQIEQLNRTKKHAHLTDTEIMTLVDETNMYEGVGRMFILQSKEAIHSQLLEKQKIAEEKIKELEQKKSYLERSVKEAEDNIREMLMARRAQ

3D Structural Models

3D Structure

Electron microscopy (6)

Domain & Motif Annotations

Protein Families

Prefoldin subunit beta family

Sequence Similarities

Belongs to the prefoldin subunit beta family.

Clinical Relevance

Antibody

HPA006499

Interaction Protein (11)

ENSG00000101132ENSG00000108262ENSG00000123349ENSG00000131653ENSG00000132305ENSG00000140395ENSG00000140854ENSG00000143256ENSG00000155959ENSG00000172354ENSG00000204220

Interaction Count

Interaction Dataset (4)

biogrid_bioplexintact_biogridintact_biogrid_bioplexbiogrid_opencell_bioplex

Supporting Publications43

PMID	Title	Related sentences
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No related sentences available
38644352	The tumour-derived extracellular vesicle proteome varies by endometrial cancer histology and is confounded by an obesogenic environment.	No related sentences available
39409015	SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy.	No related sentences available
39766158	A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis.	No related sentences available
39873726	Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer.	No related sentences available
39940641	Disease-Associated Signatures Persist in Extracellular Vesicles from Reprogrammed Cells of Osteoarthritis Patients.	No related sentences available
39949490	CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro.	No related sentences available
40091455	Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss.	No related sentences available
40311616	Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer.	No related sentences available
40545963	Extracellular Vesicle Proteome Analysis Improves Diagnosis of Recurrence in Triple-Negative Breast Cancer.	No related sentences available

Page 4 of 5Previous Next