Protein detail

LIRB3

Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)

Entry name LIRB3	UniProt ID O75022	EVMP confidence score 0.60
Supporting publications (n) 13	Transmembrane count 1	Protein classification

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information8

Protein Names

Protein Function

CD markers

Transmembrane

444..464; Helical

Transmembrane Count

Ensembl

ENSG00000204577

Entrez Gene Symbol

LILRB3

Supporting publications (n)

EVMP confidence score

0.60

Fluorescence & Localization1

Cell SpecificEnterocytes

Function & Pathway7

Protein Function

CD markers

Cellular Component (2)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Reactome (4)

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence35

Ligand-Receptor Signaling (33)

33 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	GO_Intercell	No	No	No	Yes	No

Page 2 of 4Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	LILRB3	O75022	2	PDB	PDB:8yot

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	1	38716512

Sequence, Structure & Domains11

Sequences

Length

631

Mass

69,386

Sequence

MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75022-1; Sequence=Displayed; Name=2; IsoId=O75022-2; Sequence=VSP_008459; Name=3; IsoId=O75022-3; Sequence=VSP_040126

Alternative Sequence

437; G -> GGPEDQPLNPPGSGPQNG (in isoform 2); 530; S -> SQ (in isoform 3)

3D Structural Models

3D Structure

Electron microscopy (1)

Domain & Motif Annotations

Compositional Bias

59..70; Basic and acidic residues; 473..482; Basic and acidic residues; 520..537; Basic and acidic residues; 567..581; Basic and acidic residues; 588..600; Polar residues

Motif

512..517; ITIM motif 1; 593..598; ITIM motif 2; 623..628; ITIM motif 3

Domain (CC)

Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases, including PTPN6/SHP-1, resulting in the dephosphorylation of the downstream protein kinases SYK and BTK.

Domain (FT)

42..100; Ig-like C2-type 1; 111..229; Ig-like C2-type 2; 225..314; Ig-like C2-type 3; 338..419; Ig-like C2-type 4

Region

59..78; Disordered; 470..631; Disordered

Supporting Publications13

PMID	Title	Abstract
27723984	Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection.	No abstract available
30550287	Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes.	No abstract available
32795414	Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers.	Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers.
33709510	Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection.	No abstract available
36293503	Small Extracellular Vesicles from Hypoxic Triple-Negative Breast Cancer Cells Induce Oxygen-Dependent Cell Invasion.	No abstract available
36332889	A comparative Proteomics Analysis Identified Differentially Expressed Proteins in Pancreatic Cancer-Associated Stellate Cell Small Extracellular Vesicles.	No abstract available
36406491	Automated Proteomics Sample Preparation of Phosphatidylserine-Positive Extracellular Vesicles from Human Body Fluids.	No abstract available
38225453	Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions.	No abstract available
38490958	Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer.	No abstract available
38564289	Proteomic profiles of peritoneal fluid-derived small extracellular vesicles correlate with patient outcome in ovarian cancer.	No abstract available

Page 1 of 2Next