Protein detail
LIRB3
Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)
Entry name LIRB3 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 13 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)
Protein Function
CD markers
Transmembrane
444..464; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
13
EVMP confidence score
0.72
Fluorescence & Localization
Cell SpecificEnterocytes
Function & Pathway
Protein Function
CD markers
Cellular Component (2)
Molecular Function (3)
Biological Process (3)
Reactome (4)
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence35
Ligand-Receptor Signaling (33)
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | Cellinker | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| receptor | receptor | CellCellInteractions | Yes | Yes |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
631
Mass
69,386
Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75022-1; Sequence=Displayed; Name=2; IsoId=O75022-2; Sequence=VSP_008459; Name=3; IsoId=O75022-3; Sequence=VSP_040126
Alternative Sequence
437; G -> GGPEDQPLNPPGSGPQNG (in isoform 2); 530; S -> SQ (in isoform 3)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
59..70; Basic and acidic residues; 473..482; Basic and acidic residues; 520..537; Basic and acidic residues; 567..581; Basic and acidic residues; 588..600; Polar residues
Motif
512..517; ITIM motif 1; 593..598; ITIM motif 2; 623..628; ITIM motif 3
Domain (CC)
Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases, including PTPN6/SHP-1, resulting in the dephosphorylation of the downstream protein kinases SYK and BTK.
Domain (FT)
42..100; Ig-like C2-type 1; 111..229; Ig-like C2-type 2; 225..314; Ig-like C2-type 3; 338..419; Ig-like C2-type 4
Region
59..78; Disordered; 470..631; Disordered
Supporting Publications13
| PMID | Title | Related sentences |
|---|---|---|
| 27723984 | Proteomic and Bioinformatic Characterization of Extracellular Vesicles Released from Human Macrophages upon Influenza A Virus Infection. | No related sentences available |
| 30550287 | Label-Free Proteomic Analysis of Exosomes Secreted from THP-1-Derived Macrophages Treated with IFN-α Identifies Antiviral Proteins Enriched in Exosomes. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 36293503 | Small Extracellular Vesicles from Hypoxic Triple-Negative Breast Cancer Cells Induce Oxygen-Dependent Cell Invasion. | No related sentences available |
| 36332889 | A comparative Proteomics Analysis Identified Differentially Expressed Proteins in Pancreatic Cancer-Associated Stellate Cell Small Extracellular Vesicles. | No related sentences available |
| 36406491 | Automated Proteomics Sample Preparation of Phosphatidylserine-Positive Extracellular Vesicles from Human Body Fluids. | No related sentences available |
| 38225453 | Deep proteomic analysis of obstetric antiphospholipid syndrome by DIA-MS of extracellular vesicle enriched fractions. | No related sentences available |
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No related sentences available |
| 38564289 | Proteomic profiles of peritoneal fluid-derived small extracellular vesicles correlate with patient outcome in ovarian cancer. | No related sentences available |
Page 1 of 2Next