Protein detail
LIRB3
Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)
Protein symbol LIRB3 | UniProt ID | EVMP score 0.60 |
Frequency 13 | Transmembrane count 1 | Protein classification |
Basic Information
Protein Names
Leukocyte immunoglobulin-like receptor subfamily B member 3 (LIR-3) (Leukocyte immunoglobulin-like receptor 3) (CD85 antigen-like family member A) (Immunoglobulin-like transcript 5) (ILT-5) (Monocyte inhibitory receptor HL9) (CD antigen CD85a)
Protein Function
CD markers
Transmembrane
444..464; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Frequency
13
EVMP Score
0.60
Fluorescence & Localization
Cell SpecificEnterocytes
Function & Pathway
Protein Function
CD markers
Cellular Component
Molecular Function
Biological Process
Reactome
Mediation Categories
Fusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | HPMR | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryWestern blotting | 1 | 38716512 |
Sequence, Structure & Domains
Sequences
Length
631
Mass
69,386
Sequence
MTPALTALLCLGLSLGPRTRVQAGPFPKPTLWAEPGSVISWGSPVTIWCQGSQEAQEYRLHKEGSPEPLDRNNPLEPKNKARFSIPSMTEHHAGRYRCHYYSSAGWSEPSDPLEMVMTGAYSKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSRGFQALFPVGPVTPSHRWRFTCYYYYTNTPWVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYNRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSNGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSWWQFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSHPSEPLELVVSGHSGGSSLPPTGPPSTPGLGRYLEVLIGVSVAFVLLLFLLLFLLLRRQRHSKHRTSDQRKTDFQRPAGAAETEPKDRGLLRRSSPAADVQEENLYAAVKDTQSEDRVELDSQSPHDEDPQAVTYAPVKHSSPRREMASPPSSLSGEFLDTKDRQVEEDRQMDTEAAASEASQDVTYAQLHSLTLRRKATEPPPSQEGEPPAEPSIYATLAIH
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75022-1; Sequence=Displayed; Name=2; IsoId=O75022-2; Sequence=VSP_008459; Name=3; IsoId=O75022-3; Sequence=VSP_040126
Alternative Sequence
437; G -> GGPEDQPLNPPGSGPQNG (in isoform 2); 530; S -> SQ (in isoform 3)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
59..70; Basic and acidic residues; 473..482; Basic and acidic residues; 520..537; Basic and acidic residues; 567..581; Basic and acidic residues; 588..600; Polar residues
Motif
512..517; ITIM motif 1; 593..598; ITIM motif 2; 623..628; ITIM motif 3
Domain (CC)
Contains 3 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases, including PTPN6/SHP-1, resulting in the dephosphorylation of the downstream protein kinases SYK and BTK.
Domain (FT)
42..100; Ig-like C2-type 1; 111..229; Ig-like C2-type 2; 225..314; Ig-like C2-type 3; 338..419; Ig-like C2-type 4
Region
59..78; Disordered; 470..631; Disordered