Protein detail

ICOSL

ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)

Entry name ICOSL	UniProt ID O75144	EVMP confidence score 0.50
Supporting publications (n) 5	Transmembrane count 1	Protein classification CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)

Protein Class (4)

CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (2)

CD markers
Predicted intracellular proteins

Transmembrane

257..277; Helical

Transmembrane Count

Ensembl

ENSG00000160223

Entrez Gene Symbol

ICOSLG

Gene Synonym (10)

B7-H2B7hB7H2B7RP-1B7RP1CD275GL50ICOS-LICOSLKIAA0653

Gene Description

Inducible T cell costimulator ligand

Chromosome

Position

44215382-44241446

Supporting publications (n)

EVMP confidence score

0.50

Fluorescence & Localization4

Cell SpecificPlateletsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway8

Protein Function (2)

CD markers
Predicted intracellular proteins

Cellular Component (5)

Molecular Function (3)

Biological Process (3)

KEGG (2)

Reactome (3)

Canonical Pathways (3)

M1315 Sig pip3 signaling in b lymphocytes
M8626 Sig bcr signaling pathway
M7955 Sig insulin receptor pathway in cardiac myocytes

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence46

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ICOSLG	PRKCA	P17252	S	285	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (40)

40 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	DGIdb	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	connectomeDB2020	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellChatDB	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	Baccin2019	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	CellPhoneDB	Yes	No	No	Yes	No
b7_family	cell_surface_ligand	HGNC	Yes	No	No	Yes	No
cell_surface_ligand	cell_surface_ligand	OmniPath	Yes	No	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
ICOSL	O75144	ICOS	Q9Y6W8	Yes	Yes	No	iTALKKEGG-MEDICUSICELLNETSIGNORHINTCellPhoneDB_CellinkerUniProt_LRdbCellChatDBHPRDWojtowicz2020IntActWangCellPhoneDBBioGRIDBaccin2019CellinkerCellTalkDBNetPathconnectomeDB2020SPIKE_LCLRdbSPIKE	CellTalkDB:23954143 HPRD:10657606 IntAct:16951355 CellChatDB:23954143 HINT:11956294 SIGNOR:27559335 SPIKE_LC:10657606 NetPath:10657606 ICELLNET:14599850 BioGRID:11956294 Cellinker:23954143 Cellinker:25769613 Cellinker:29879883 HINT:16951355 connectomeDB2020:14599850 SPIKE:10657606 connectomeDB2020:23954143 ICELLNET:23954143 HINT:33033255 Cellinker:21955433 IntAct:11956294 HPRD:11023515 HPRD:11956294
KPCA	P17252	ICOSL	O75144	Yes	Yes	No	SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper	SIGNOR:24837102 PhosphoSite:24837102
KPCB	P05771	ICOSL	O75144	Yes	Yes	No	SIGNOR	SIGNOR:24837102

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	ICOSLG	O75144	2	PDB	PDB:6x4t

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryMass spectrometry [LTQ-FT Ultra]	2	38395386 38589887

Sequence, Structure & Domains12

Sequences

Length

302

Mass

33,349

Sequence

MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75144-1; Sequence=Displayed; Name=2; IsoId=O75144-2; Sequence=VSP_002520; Name=3; IsoId=O75144-3; Sequence=VSP_054718

Alternative Sequence

18..134; Missing (in isoform 3); 300..302; GHV -> ESWNLLLLLS (in isoform 2)

3D Structural Models

Turn

47..49; 78..83; 118..121; 174..177; 220..223

Helix

88..92; 105..107; 182..184; 193..195

Beta Strand

20..28; 33..35; 50..59; 62..66; 84..86; 98..102; 109..117; 122..136; 142..144; 155..165; 168..173; 185..191; 197..204; 213..219; 224..229

3D Structure

X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

19..129; Ig-like V-type; 141..227; Ig-like C2-type

Protein Families (2)

Immunoglobulin superfamily
BTN/MOG family

Sequence Similarities

Belongs to the immunoglobulin superfamily. BTN/MOG family.

Clinical Relevance6

Drug Targets

Clinical trial target

Drugs (2)

AMG-557 NULL

Antibody (3)

CAB026037 HPA029179 CAB079997

Interaction Protein

ENSG00000163600

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications5

PMID	Title	Abstract
28986585	Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics.	No abstract available
32089743	Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism.	No abstract available
36797805	Magnetic transferrin nanoparticles (MTNs) assay as a novel isolation approach for exosomal biomarkers in neurological diseases.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available