Protein detail
ICOSL
ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
Entry name ICOSL | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 5 | Transmembrane count 1 | Protein classification CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
ICOS ligand (B7 homolog 2) (B7-H2) (B7-like protein Gl50) (B7-related protein 1) (B7RP-1) (CD antigen CD275)
Protein Class (4)
CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
257..277; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (10)
B7-H2B7hB7H2B7RP-1B7RP1CD275GL50ICOS-LICOSLKIAA0653
Gene Description
Inducible T cell costimulator ligand
Chromosome
21
Position
44215382-44241446
Supporting publications (n)
5
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificPlateletsSingle-Nuclei Brain Specificendothelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
KEGG (2)
Reactome (3)
Canonical Pathways (3)
- M1315 Sig pip3 signaling in b lymphocytes
- M8626 Sig bcr signaling pathway
- M7955 Sig insulin receptor pathway in cardiac myocytes
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence46
Enzyme-Mediated Modification (1)
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ICOSLG | PRKCA | P17252 | S | 285 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (40)
40 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | MCAM | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | CellPhoneDB | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| ICOSL | O75144 | ICOS | Q9Y6W8 | Yes | Yes | iTALKKEGG-MEDICUSICELLNETSIGNORHINTCellPhoneDB_CellinkerUniProt_LRdbCellChatDBHPRDWojtowicz2020IntActWangCellPhoneDBBioGRIDBaccin2019CellinkerCellTalkDBNetPathconnectomeDB2020SPIKE_LCLRdbSPIKE | CellTalkDB:23954143HPRD:10657606IntAct:16951355CellChatDB:23954143HINT:11956294SIGNOR:27559335SPIKE_LC:10657606NetPath:10657606ICELLNET:14599850BioGRID:11956294Cellinker:23954143Cellinker:25769613Cellinker:29879883HINT:16951355connectomeDB2020:14599850SPIKE:10657606connectomeDB2020:23954143ICELLNET:23954143HINT:33033255Cellinker:21955433IntAct:11956294HPRD:11023515HPRD:11956294 | |
| KPCA | P17252 | ICOSL | O75144 | Yes | Yes | SIGNORPhosphoSitePhosphoSite_ProtMapperProtMapper | SIGNOR:24837102PhosphoSite:24837102 | |
| KPCB | P05771 | ICOSL | O75144 | Yes | Yes | SIGNOR | SIGNOR:24837102 |
Protein Complex Composition (1)
Sequence, Structure & Domains
Sequences
Length
302
Mass
33,349
Sequence
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTGHV
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75144-1; Sequence=Displayed; Name=2; IsoId=O75144-2; Sequence=VSP_002520; Name=3; IsoId=O75144-3; Sequence=VSP_054718
Alternative Sequence
18..134; Missing (in isoform 3); 300..302; GHV -> ESWNLLLLLS (in isoform 2)
3D Structural Models
Turn
47..49; 78..83; 118..121; 174..177; 220..223
Helix
88..92; 105..107; 182..184; 193..195
Beta Strand
20..28; 33..35; 50..59; 62..66; 84..86; 98..102; 109..117; 122..136; 142..144; 155..165; 168..173; 185..191; 197..204; 213..219; 224..229
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
19..129; Ig-like V-type; 141..227; Ig-like C2-type
Protein Families (2)
- Immunoglobulin superfamily
- BTN/MOG family
Sequence Similarities
Belongs to the immunoglobulin superfamily. BTN/MOG family.
Clinical Relevance
Supporting Publications5
| PMID | Title | Related sentences |
|---|---|---|
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 36797805 | Magnetic transferrin nanoparticles (MTNs) assay as a novel isolation approach for exosomal biomarkers in neurological diseases. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |