Protein detail
TULP3
Tubby-related protein 3 (Tubby-like protein 3)
Entry name TULP3 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Disease related genesPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Tubby-related protein 3 (Tubby-like protein 3)
Protein Class (2)
Disease related genesPredicted intracellular proteins
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
TUBL3
Gene Description
TUB like protein 3
Chromosome
12
Position
2877223-2941138
Supporting publications (n)
1
EVMP confidence score
0.28
Fluorescence & Localization
Tissue SpecificbrainCell SpecificEarly spermatidsBlood Cell Specificneutrophil
Function & Pathway
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
Mediation Categories
Receptor-signaling mediation
Relations & Evidence16
Ligand-Receptor Signaling (14)
14 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes | ||||
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | OmniPath | Yes |
Page 2 of 2Previous
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| TULP3 | O75386 | GP161 | Q8N6U8 | Yes | Yes | SIGNOR | SIGNOR:23332756 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | R Sequencing | 1 | 31805958 |
Sequence, Structure & Domains
Sequences
Length
442
Mass
49,642
Sequence
MEASRCRLSPSGDSVFHEEMMKMRQAKLDYQRLLLEKRQRKKRLEPFMVQPNPEARLRRAKPRASDEQTPLVNCHTPHSNVILHGIDGPAAVLKPDEVHAPSVSSSVVEEDAENTVDTASKPGLQERLQKHDISESVNFDEETDGISQSACLERPNSASSQNSTDTGTSGSATAAQPADNLLGDIDDLEDFVYSPAPQGVTVRCRIIRDKRGMDRGLFPTYYMYLEKEENQKIFLLAARKRKKSKTANYLISIDPVDLSREGESYVGKLRSNLMGTKFTVYDRGICPMKGRGLVGAAHTRQELAAISYETNVLGFKGPRKMSVIIPGMTLNHKQIPYQPQNNHDSLLSRWQNRTMENLVELHNKAPVWNSDTQSYVLNFRGRVTQASVKNFQIVHKNDPDYIVMQFGRVADDVFTLDYNYPLCAVQAFGIGLSSFDSKLACE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=O75386-1; Sequence=Displayed; Name=2; IsoId=O75386-2; Sequence=VSP_054752; Name=3; IsoId=O75386-3; Sequence=VSP_055761, VSP_055762, VSP_055763
Alternative Sequence
1..19; Missing (in isoform 3); 165..189; DTGTSGSATAAQPADNLLGDIDDLE -> FSSFCQKTEDTGYRHFRFCYCRPTS (in isoform 3); 190..442; Missing (in isoform 3); 437..442; SKLACE -> KCIQTLRMQELCELHRQHHSAASLVHRTVCQRWVGHPWRLLPQTSLLWTDLSPPPVVPAPHQISM (in isoform 2)
3D Structural Models
3D Structure
Electron microscopy (1)
Domain & Motif Annotations
Compositional Bias
145..162; Polar residues; 163..175; Low complexity
Region
23..68; Required for association with the IFT complex A (IFT-A); 101..177; Disordered
Protein Families
TUB family
Sequence Similarities
Belongs to the TUB family.
Clinical Relevance
Disease Involvement (2)
CiliopathyDisease variant
Interaction Protein (9)
ENSG00000100124ENSG00000112182ENSG00000118965ENSG00000119650ENSG00000123607ENSG00000141568ENSG00000157796ENSG00000163913ENSG00000187535
Interaction Count
9
Interaction Dataset (3)
intact_biogrid_opencellintact_biogridintact_biogrid_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 34265469 | Proteomic Landscape of Exosomes Reveals the Functional Contributions of CD151 in Triple-Negative Breast Cancer. | Furthermore, utilizing quantitative proteomics approach to reveal the proteomes of CD151-deleted exosomes and cells, we found that exosomal CD151 facilitated secretion of ribosomal proteins via exosomes while inhibiting exosome secretion of complement proteins. Moreover, we proved that CD151-deleted exosomes significantly decreased the migration and invasion of TNBC cells. Most importantly, we found that the tetraspanin CD151 expression levels in TNBC-derived serum exosomes were significantly higher than those exosomes from healthy subjects, and we validated our findings with samples from 16 additional donors. This is the first comparative study of the proteomes of TNBC patient-derived and CD151-deleted exosomes. |