Protein detail

MTU1

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Entry name MTU1	UniProt ID O75648	EVMP score 0.38
Frequency 2	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Protein Class

Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Ensembl

ENSG00000104907

Entrez Gene Symbol

TRMT1

Gene Synonym

FLJ20244TRM1

Gene Description

TRNA methyltransferase 1

Chromosome

Position

13104902-13117567

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificheart muscleCell SpecificCardiomyocytes

Function & Pathway

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Cellular Component

Molecular Function

Biological Process

Reactome

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

51 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
BUD23-TRM112 methyltransferase complex	BUD23 TRMT112	O43709 Q9UI30	1:1	ComplexPortalhu.MAPhu.MAP2	intact:EBI-9027273	26214185 14755292 25851604 34948388
HSD17B10-TRMT10C complex	HSD17B10 TRMT10C	Q7L0Y3 Q99714	2:4	CORUMComplexPortalPDB	intact:EBI-25827553CORUM:7429PDB:8cboPDB:9gch	23042678 29040705 14755292 29880640
HT_DM_Cluster140	ETFB HEMK2 TRMT112	P38117 Q9UI30 Q9Y5N5	1:1:1	Compleat	Compleat:HC1276	22036573
HT_DM_Cluster450	KIF20A KIF20B TRMT1	O95235 Q96Q89 Q9NXH9	1:1:1	Compleat	Compleat:HC3288	22036573
Mitochondrial CCA tRNA nucleotidyltransferase 1 complex	HSD17B10 TRMT10C TRNT1	Q7L0Y3 Q96Q11 Q99714	2:1:4	ComplexPortalPDB	PDB:8CBOintact:EBI-61098031PDB:8CBMPDB:8cbm	39516281 38824131 14755292 21593607
Mitochondrial RNase Z complex	ELAC2 HSD17B10 TRMT10C	Q7L0Y3 Q99714 Q9BQ52	2:4:1	ComplexPortalPDB	PDB:9ey1PDB:8rr4PDB:8cboPDB:8cblPDB:9ey0PDB:8rr3intact:EBI-9010244PDB:9ey2PDB:8rr1	39516281 38824131 14755292 21593607
N6AMT1-TRM112 methyltransferase complex	HEMK2 TRMT112	Q9UI30 Q9Y5N5	2:2	ComplexPortalPDB	PDB:9fkgPDB:9fl4PDB:6kmrPDB:6kmsPDB:9fkePDB:6KMSPDB:6pedPDB:6H1DPDB:9fkwPDB:6khsPDB:6PEDPDB:8qdiPDB:6h1ePDB:6k0xPDB:6K0XPDB:8cncPDB:9fkvPDB:9fimPDB:8qdgintact:EBI-9027184PDB:6h1dPDB:9fl5PDB:6KMRPDB:6KHSPDB:9fkm	14755292 31061526 34948388
THUMPD2-TRM112 methyltransferase complex	THUMPD2 TRMT112	Q9BTF0 Q9UI30	1:1	ComplexPortal	intact:EBI-9026937	14755292 34948388
THUMPD3-TRM112 methyltransferase complex	THUMPD3 TRMT112	Q9BV44 Q9UI30	1:1	ComplexPortal	intact:EBI-9017626	14755292 34669960 34948388
TIM22 complex	AGK TIMM10 TIMM22 TIMM29 TIMM9 TRMT10B	P62072 Q53H12 Q6PF06 Q9BSF4 Q9Y584 Q9Y5J7	2:1:1:1:1:2	SIGNORComplexPortal	PDB:7CGPintact:EBI-25818001SIGNOR:SIGNOR-C424	32901109 14755292

Page 1 of 6Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	35399949 38716512

Sequence, Structure & Domains

Sequences

Length

421

Mass

47,745

Sequence

MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394

Alternative Sequence

1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)

3D Structural Models

Domain & Motif Annotations

Region

96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered

Protein Families

MnmA/TRMU family

Sequence Similarities

Belongs to the MnmA/TRMU family.

Clinical Relevance

Disease Involvement

Disease variantIntellectual disability

Antibody

HPA041130 HPA041380