Protein detail
MTU1
Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)
Entry name MTU1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)
Protein Class (7)
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (6)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ20244TRM1
Gene Description
TRNA methyltransferase 1
Chromosome
19
Position
13104902-13117567
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization2
Tissue Specificheart muscleCell SpecificCardiomyocytes
Function & Pathway6
Protein Function (6)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Disease related genes
Cellular Component (3)
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories
Other mediation
Relations & Evidence57
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Protein Complex Composition (51)
51 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| BUD23-TRM112 methyltransferase complex | BUD23TRMT112 | O43709Q9UI30 | 1:1 | ComplexPortalhu.MAPhu.MAP2 | intact:EBI-9027273 | 26214185147552922585160434948388 |
| HSD17B10-TRMT10C complex | HSD17B10TRMT10C | Q7L0Y3Q99714 | 2:4 | CORUMComplexPortalPDB | intact:EBI-25827553CORUM:7429PDB:8cboPDB:9gch | 23042678290407051475529229880640 |
| HT_DM_Cluster140 | ETFBHEMK2TRMT112 | P38117Q9UI30Q9Y5N5 | 1:1:1 | Compleat | Compleat:HC1276 | 22036573 |
| HT_DM_Cluster450 | KIF20AKIF20BTRMT1 | O95235Q96Q89Q9NXH9 | 1:1:1 | Compleat | Compleat:HC3288 | 22036573 |
| Mitochondrial CCA tRNA nucleotidyltransferase 1 complex | HSD17B10TRMT10CTRNT1 | Q7L0Y3Q96Q11Q99714 | 2:1:4 | ComplexPortalPDB | PDB:8CBOintact:EBI-61098031PDB:8CBMPDB:8cbm | 39516281388241311475529221593607 |
| Mitochondrial RNase Z complex | ELAC2HSD17B10TRMT10C | Q7L0Y3Q99714Q9BQ52 | 2:4:1 | ComplexPortalPDB | PDB:9ey1PDB:8rr4PDB:8cboPDB:8cblPDB:9ey0PDB:8rr3intact:EBI-9010244PDB:9ey2PDB:8rr1 | 39516281388241311475529221593607 |
| N6AMT1-TRM112 methyltransferase complex | HEMK2TRMT112 | Q9UI30Q9Y5N5 | 2:2 | ComplexPortalPDB | PDB:9fkgPDB:9fl4PDB:6kmrPDB:6kmsPDB:9fkePDB:6KMSPDB:6pedPDB:6H1DPDB:9fkwPDB:6khsPDB:6PEDPDB:8qdiPDB:6h1ePDB:6k0xPDB:6K0XPDB:8cncPDB:9fkvPDB:9fimPDB:8qdgintact:EBI-9027184PDB:6h1dPDB:9fl5PDB:6KMRPDB:6KHSPDB:9fkm | 147552923106152634948388 |
| THUMPD2-TRM112 methyltransferase complex | THUMPD2TRMT112 | Q9BTF0Q9UI30 | 1:1 | ComplexPortal | intact:EBI-9026937 | 1475529234948388 |
| THUMPD3-TRM112 methyltransferase complex | THUMPD3TRMT112 | Q9BV44Q9UI30 | 1:1 | ComplexPortal | intact:EBI-9017626 | 147552923466996034948388 |
| TIM22 complex | AGKTIMM10TIMM22TIMM29TIMM9TRMT10B | P62072Q53H12Q6PF06Q9BSF4Q9Y584Q9Y5J7 | 2:1:1:1:1:2 | SIGNORComplexPortal | PDB:7CGPintact:EBI-25818001SIGNOR:SIGNOR-C424 | 3290110914755292 |
Page 1 of 6Next
Sequence, Structure & Domains8
Sequences
Length
421
Mass
47,745
Sequence
MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394
Alternative Sequence
1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)
Domain & Motif Annotations
Region
96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered
Protein Families
MnmA/TRMU family
Sequence Similarities
Belongs to the MnmA/TRMU family.