Protein detail

MTU1

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Entry name MTU1	UniProt ID O75648	EVMP score 0.38
Frequency 2	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Protein Class

Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Ensembl

ENSG00000104907

Entrez Gene Symbol

TRMT1

Gene Synonym

FLJ20244TRM1

Gene Description

TRNA methyltransferase 1

Chromosome

Position

13104902-13117567

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificheart muscleCell SpecificCardiomyocytes

Function & Pathway

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Cellular Component

Molecular Function

Biological Process

Reactome

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

51 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
adoMet-dependent tRNA methyltransferase (Mtase) Complex	TRMT11 TRMT112	Q7Z4G4 Q9UI30	1:1	CompleatComplexPortal	intact:EBI-9026891Compleat:HC2650	14755292 15899842 34948388
mtRNase P	HSD17B10 PRORP TRMT10C	O15091 Q7L0Y3 Q99714	1:2:4	CORUMComplexPortalPDB	PDB:8CBOintact:EBI-25827056PDB:7ONUPDB:7onuPDB:8cbkCORUM:7428	29880640 18984158 23042678 34489609 14755292 38824131
	JRK TRMT10C VWA5A	O00534 O75564 Q7L0Y3	0:0:0	hu.MAP2
	CREBZF JRK KIF12 TRMT10C VWA5A	O00534 O75564 Q7L0Y3 Q96FN5 Q9NS37	0:0:0:0:0	hu.MAP2
	CCT2 CCT4 CCT6A CCT7 EEF1A1 IGBP1 PPP2CB PPP2R2D PPP4C PPP6C PTPA SARS2 TCP1 TIPRL TRMT10C	O00743 O75663 P17987 P40227 P50991 P60510 P62714 P68104 P78318 P78371 Q15257 Q66LE6 Q7L0Y3 Q99832 Q9NP81	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4055
	CARS2 HSPA13 IMPA2 POLE POLE2 POLE3 POLE4 RAD17 TRMT10C	O14732 O75943 P48723 P56282 Q07864 Q7L0Y3 Q9HA77 Q9NR33 Q9NRF9	1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4827
	HSD17B10 MRPL58 PRORP RARS2 SHMT2 TRMT10C TUFM	O15091 P34897 P49411 Q14197 Q5T160 Q7L0Y3 Q99714	1:1:1:1:1:1:1	CompleatCFinder	Compleat:HC9486
	HSD17B10 MRPL58 PRORP TRMT10C	O15091 Q14197 Q7L0Y3 Q99714	1:1:1:1	CompleatCFinder	Compleat:HC5560
	CREBBP DAXX EP300 HSPA1B KLF13 N4BP2 NPRL3 PLAGL1 TP53 TP63 TP73 TRMT11	O15350 P04637 P0DMV9 Q09472 Q12980 Q7Z4G4 Q86UW6 Q92793 Q9H3D4 Q9UER7 Q9UM63 Q9Y2Y9	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4905
	BRD8 IMPDH1 NPRL3 PIWIL1 TP53 TP63 TP73 TRMT11	O15350 P04637 P20839 Q12980 Q7Z4G4 Q96J94 Q9H0E9 Q9H3D4	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3711

Page 2 of 6Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	35399949 38716512

Sequence, Structure & Domains

Sequences

Length

421

Mass

47,745

Sequence

MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394

Alternative Sequence

1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)

3D Structural Models

Domain & Motif Annotations

Region

96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered

Protein Families

MnmA/TRMU family

Sequence Similarities

Belongs to the MnmA/TRMU family.

Clinical Relevance

Disease Involvement

Disease variantIntellectual disability

Antibody

HPA041130 HPA041380