Protein detail

MTU1

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Entry name MTU1	UniProt ID O75648	EVMP confidence score 0.38
Supporting publications (n) 2	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Protein Class (7)

Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

Protein Function (6)

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Ensembl

ENSG00000104907

Entrez Gene Symbol

TRMT1

Gene Synonym (2)

FLJ20244TRM1

Gene Description

TRNA methyltransferase 1

Chromosome

Position

13104902-13117567

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization2

Tissue Specificheart muscleCell SpecificCardiomyocytes

Function & Pathway6

Protein Function (6)

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Cellular Component (3)

Molecular Function (5)

Biological Process (3)

Reactome (3)

Mediation Categories

Other mediation

Relations & Evidence57

Ligand-Receptor Signaling (5)

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Protein Complex Composition (51)

51 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
EP300 N4BP2 NPRL3 PAX6 PIWIL1 TP53 TP63 TP73 TRMT11 ZNF592	O15350 P04637 P26367 Q09472 Q12980 Q7Z4G4 Q86UW6 Q92610 Q96J94 Q9H3D4	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6774
EP300 N4BP2 NPRL3 PAX6 PIWIL1 SPSB1 TP53 TP63 TP73 TRMT11	O15350 P04637 P26367 Q09472 Q12980 Q7Z4G4 Q86UW6 Q96BD6 Q96J94 Q9H3D4	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9175
CDT1 EP300 N4BP2 NPRL3 PIWIL1 TP53 TP63 TP73 TRAPPC11 TRMT11	O15350 P04637 Q09472 Q12980 Q7Z392 Q7Z4G4 Q86UW6 Q96J94 Q9H211 Q9H3D4	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7790
CREBBP DAXX EP300 HIPK2 N4BP2 NPRL3 PLAGL1 TP53 TP63 TP73 TRMT11	O15350 P04637 Q09472 Q12980 Q7Z4G4 Q86UW6 Q92793 Q9H2X6 Q9H3D4 Q9UER7 Q9UM63	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8627
AGO2 DICER1 NPRL3 PIWIL1 PIWIL4 SENP2 TARBP2 TP53 TP63 TP73 TRMT11	O15350 P04637 Q12980 Q15633 Q7Z3Z4 Q7Z4G4 Q96J94 Q9H3D4 Q9HC62 Q9UKV8 Q9UPY3	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8028
AARS1 AIMP1 AIMP2 ASNS DARS1 EEF1E1 EPRS1 GARS1 IARS1 KARS1 LARS1 MARS1 NARS1 QARS1 RARS1 TRMT1 UBA1 VBP1	O43324 O43776 P07814 P08243 P14868 P22314 P41250 P41252 P47897 P49588 P54136 P56192 P61758 Q12904 Q13155 Q15046 Q9NXH9 Q9P2J5	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_610
AASS GET3 GET4 SEC22B SGTA TRMT112 UBC UBL4A	O43681 O43765 O75396 P0CG48 P11441 Q7L5D6 Q9UDR5 Q9UI30	1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6942
ASS1 BUD23 GALC PFKM TRMT11 TRMT112	O43709 P00966 P08237 P54803 Q7Z4G4 Q9UI30	0:0:0:0:0:0	hu.MAP2
BUD23 BYSL CSNK1A1 FAU LTV1 PNO1 RPS11 RPS12 RPS13 RPS14 RPS15 RPS15A RPS16 RPS17 RPS18 RPS19 RPS23 RPS24 RPS25 RPS27 RPS27A RPS28 RPS3A RPS4X RPS5 RPS6 RPS7 RPS8 RPS9 RRP12 SLX9 TRMT112 TSR1	O43709 P08708 P25398 P39019 P42677 P46781 P46782 P48729 P61247 P62081 P62241 P62244 P62249 P62263 P62266 P62269 P62277 P62280 P62701 P62753 P62841 P62847 P62851 P62857 P62861 P62979 Q13895 Q2NL82 Q5JTH9 Q96GA3 Q9NRX1 Q9NSI2 Q9UI30	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	PDB	PDB:7wtt
BUD23 BYSL FAU LTV1 PNO1 RPS11 RPS12 RPS13 RPS14 RPS15 RPS15A RPS16 RPS17 RPS18 RPS19 RPS23 RPS24 RPS25 RPS27 RPS27A RPS28 RPS3A RPS4X RPS5 RPS6 RPS7 RPS8 RPS9 RRP12 SLX9 TRMT112 TSR1	O43709 P08708 P25398 P39019 P42677 P46781 P46782 P61247 P62081 P62241 P62244 P62249 P62263 P62266 P62269 P62277 P62280 P62701 P62753 P62841 P62847 P62851 P62857 P62861 P62979 Q13895 Q2NL82 Q5JTH9 Q96GA3 Q9NRX1 Q9NSI2 Q9UI30	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	PDB	PDB:7wtu

Page 3 of 6Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	35399949 38716512

Sequence, Structure & Domains8

Sequences

Length

421

Mass

47,745

Sequence

MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394

Alternative Sequence

1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)

Domain & Motif Annotations

Region

96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered

Protein Families

MnmA/TRMU family

Sequence Similarities

Belongs to the MnmA/TRMU family.

Clinical Relevance2

Disease Involvement (2)

Disease variantIntellectual disability

Antibody (2)

HPA041130 HPA041380

Supporting Publications2

PMID	Title	Abstract
27894104	Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers.	No abstract available
38321535	Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles.	No abstract available