Protein detail

MTU1

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Entry name MTU1	UniProt ID O75648	EVMP score 0.38
Frequency 2	Transmembrane count	Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)

Protein Class

Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Ensembl

ENSG00000104907

Entrez Gene Symbol

TRMT1

Gene Synonym

FLJ20244TRM1

Gene Description

TRNA methyltransferase 1

Chromosome

Position

13104902-13117567

Frequency

EVMP Score

0.38

Fluorescence & Localization

Tissue Specificheart muscleCell SpecificCardiomyocytes

Function & Pathway

Protein Function

Human disease related genes:Other diseases:Mental and behavioural disorders
Predicted intracellular proteins
ENZYME proteins:Transferases
Potential drug targets
Enzymes
Disease related genes

Cellular Component

Molecular Function

Biological Process

Reactome

Mediation Categories

Other mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

5 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	LOCATE	No	No	No	No	No
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network

0 records.

Protein Complex Composition

51 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
BUD23 BYSL FAU LTV1 PNO1 RPS11 RPS13 RPS14 RPS15 RPS15A RPS16 RPS17 RPS18 RPS19 RPS23 RPS24 RPS25 RPS27 RPS28 RPS3A RPS4X RPS5 RPS6 RPS7 RPS8 RPS9 TRMT112 TSR1	O43709 P08708 P39019 P42677 P46781 P46782 P61247 P62081 P62241 P62244 P62249 P62263 P62266 P62269 P62277 P62280 P62701 P62753 P62841 P62847 P62851 P62857 P62861 Q13895 Q2NL82 Q96GA3 Q9NRX1 Q9UI30	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	PDB	PDB:6g4w
BUD23 DIMT1 FAU PNO1 RPS11 RPS13 RPS14 RPS15A RPS23 RPS24 RPS27 RPS3A RPS4X RPS6 RPS7 RPS8 RPS9 RRP12 SLX9 TRMT112 TSR1 UTP14A	O43709 P42677 P46781 P61247 P62081 P62241 P62244 P62263 P62266 P62277 P62280 P62701 P62753 P62847 P62861 Q2NL82 Q5JTH9 Q9BVJ6 Q9NRX1 Q9NSI2 Q9UI30 Q9UNQ2	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	PDB	PDB:7wts
BUD23 GALC TRMT11 TRMT112	O43709 P54803 Q7Z4G4 Q9UI30	0:0:0:0	hu.MAP2
DAP3 ERAL1 MRPS10 MRPS11 MRPS14 MRPS15 MRPS16 MRPS17 MRPS18B MRPS18C MRPS2 MRPS21 MRPS22 MRPS23 MRPS24 MRPS25 MRPS26 MRPS27 MRPS28 MRPS31 MRPS33 MRPS34 MRPS35 MRPS5 MRPS6 MRPS7 MRPS9 NOA1 PTCD3 TRA2A TRMT10B	O60783 O75616 P51398 P82650 P82663 P82664 P82673 P82675 P82912 P82914 P82921 P82930 P82932 P82933 Q13595 Q6PF06 Q8NC60 Q92552 Q92665 Q96EL2 Q96EY7 Q9BYN8 Q9Y291 Q9Y2Q9 Q9Y2R5 Q9Y2R9 Q9Y399 Q9Y3D3 Q9Y3D5 Q9Y3D9 Q9Y676	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
DAP3 ERAL1 MRPS10 MRPS11 MRPS14 MRPS15 MRPS16 MRPS17 MRPS18B MRPS18C MRPS2 MRPS21 MRPS22 MRPS23 MRPS24 MRPS25 MRPS26 MRPS27 MRPS28 MRPS31 MRPS33 MRPS34 MRPS35 MRPS5 MRPS6 MRPS7 MRPS9 NOA1 PTCD3 TRMT10B	O60783 O75616 P51398 P82650 P82663 P82664 P82673 P82675 P82912 P82914 P82921 P82930 P82932 P82933 Q6PF06 Q8NC60 Q92552 Q92665 Q96EL2 Q96EY7 Q9BYN8 Q9Y291 Q9Y2Q9 Q9Y2R5 Q9Y2R9 Q9Y399 Q9Y3D3 Q9Y3D5 Q9Y3D9 Q9Y676	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP2
SEC24A TRMT1	O95486 Q9NXH9	0:0	hu.MAP
EEF1A1 ETF1 GSPT1 GSPT2 PABPC1 SARS2 SMG1 TRMT10C UBC UPF1 USP44	P0CG48 P11940 P15170 P62495 P68104 Q7L0Y3 Q8IYD1 Q92900 Q96Q15 Q9H0E7 Q9NP81	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7659
CCT2 CCT3 CCT4 CCT6A CCT7 IGBP1 PPP2CA PPP2CB PPP2R2A PPP2R2D PPP4C PTPA TCP1 TRMT1L UBC	P0CG48 P17987 P40227 P49368 P50991 P60510 P62714 P63151 P67775 P78318 P78371 Q15257 Q66LE6 Q7Z2T5 Q99832	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5780
CCNH CDK7 ERCC2 ERCC5 MNAT1 TRMT1	P18074 P28715 P50613 P51946 P51948 Q9NXH9	0:0:0:0:0:0	hu.MAP2
DHX33 H1-10 HNRNPU MEPCE RFC1 RFC2 RFC3 RFC4 RFC5 RIOX1 RPL10 RPL29 RRBP1 TRMT1L USP10	P27635 P35249 P35250 P35251 P40937 P40938 P47914 Q00839 Q14694 Q7L2J0 Q7Z2T5 Q92522 Q9H6R0 Q9H6W3 Q9P2E9	0:0:0:0:0:0:0:0:0:0:0:0:0:0:0	hu.MAP

Page 4 of 6Previous Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	2	35399949 38716512

Sequence, Structure & Domains

Sequences

Length

421

Mass

47,745

Sequence

MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394

Alternative Sequence

1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)

3D Structural Models

Domain & Motif Annotations

Region

96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered

Protein Families

MnmA/TRMU family

Sequence Similarities

Belongs to the MnmA/TRMU family.

Clinical Relevance

Disease Involvement

Disease variantIntellectual disability

Antibody

HPA041130 HPA041380