Protein detail
MTU1
Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)
Entry name MTU1 | UniProt ID | EVMP confidence score 0.28 |
Supporting publications (n) 2 | Transmembrane count | Protein classification Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Mitochondrial tRNA-specific 2-thiouridylase 1 (EC 2.8.1.14) (MTO2 homolog)
Protein Class (7)
Disease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteins
Protein Function (6)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Disease related genes
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ20244TRM1
Gene Description
TRNA methyltransferase 1
Chromosome
19
Position
13104902-13117567
Supporting publications (n)
2
EVMP confidence score
0.28
Fluorescence & Localization
Tissue Specificheart muscleCell SpecificCardiomyocytes
Function & Pathway
Protein Function (6)
- Human disease related genes:Other diseases:Mental and behavioural disorders
- Predicted intracellular proteins
- ENZYME proteins:Transferases
- Potential drug targets
- Enzymes
- Disease related genes
Cellular Component (3)
Molecular Function (5)
Biological Process (3)
Reactome (3)
Mediation Categories
Other mediation
Relations & Evidence57
Ligand-Receptor Signaling (5)
5 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | |||||
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Protein Complex Composition (51)
51 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| FEN1TRMT1LVPS52VRK1 | P39748Q7Z2T5Q8N1B4Q99986 | 0:0:0:0 | Havugimana2012 | Havugimana2012:C_184 | ||
| GALCTRMT11 | P54803Q7Z4G4 | 0:0 | hu.MAP2 | |||
| NTPCRRPS20RPS27LRRP7ATRMT1L | P60866Q71UM5Q7Z2T5Q9BSD7Q9Y3A4 | 0:0:0:0:0 | hu.MAP2 | |||
| DHX33HNRNPUIGF2BP1SPATS2LTRMT1L | Q00839Q7Z2T5Q9H6R0Q9NUQ6Q9NZI8 | 0:0:0:0:0 | hu.MAP | |||
| AMPD2TRMT1 | Q01433Q9NXH9 | 0:0 | hu.MAP | |||
| H1-10RRBP1TRMT1LUSP10 | Q14694Q7Z2T5Q92522Q9P2E9 | 0:0:0:0 | hu.MAP | |||
| TRMT12ZNF556 | Q53H54Q9HAH1 | 0:0 | hu.MAP2 | |||
| TRMT10C | Q7L0Y3 | 3 | PDB | PDB:5nfj | ||
| NTPCRTRMT1L | Q7Z2T5Q9BSD7 | 0:0 | hu.MAP2 | |||
| DHX33TRMT1LUSP36 | Q7Z2T5Q9H6R0Q9P275 | 0:0:0 | hu.MAP |
Sequence, Structure & Domains
Sequences
Length
421
Mass
47,745
Sequence
MQALRHVVCALSGGVDSAVAALLLRRRGYQVTGVFMKNWDSLDEHGVCTADKDCEDAYRVCQILDIPFHQVSYVKEYWNDVFSDFLNEYEKGRTPNPDIVCNKHIKFSCFFHYAVDNLGADAIATGHYARTSLEDEEVFEQKHVKKPEGLFRNRFEVRNAVKLLQAADSFKDQTFFLSQVSQDALRRTIFPLGGLTKEFVKKIAAENRLHHVLQKKESMGMCFIGKRNFEHFLLQYLQPRPGHFISIEDNKVLGTHKGWFLYTLGQRANIGGLREPWYVVEKDSVKGDVFVAPRTDHPALYRDLLRTSRVHWIAEEPPAALVRDKMMECHFRFRHQMALVPCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; IsoId=O75648-1; Sequence=Displayed; Name=2; IsoId=O75648-2; Sequence=VSP_035395; Name=3; IsoId=O75648-3; Sequence=VSP_035391, VSP_035392, VSP_035395; Name=4; IsoId=O75648-4; Sequence=VSP_035391, VSP_035392; Name=5; IsoId=O75648-5; Sequence=VSP_035393, VSP_035394
Alternative Sequence
1..154; Missing (in isoform 3 and isoform 4); 155..179; FEVRNAVKLLQAADSFKDQTFFLSQ -> MKKSLSRSTLRSPKGFSEIGLKLEM (in isoform 3 and isoform 4); 161..166; VKLLQA -> RFPRMP (in isoform 5); 167..421; Missing (in isoform 5); 341..421; PCVLTLNQDGTVWVTAVQAVRALATGQFAVFYKGDECLGSGKILRLGPSAYTLQKGQRRAGMATESPSDSPEDGPGLSPLL -> CCVLQGGRVPGQREDPAAGAVCLHAPEGPAQSWDGH (in isoform 2 and isoform 3)
Domain & Motif Annotations
Region
96..98; Interaction with target base in tRNA; 171..173; Interaction with tRNA; 334..335; Interaction with tRNA; 395..421; Disordered
Protein Families
MnmA/TRMU family
Sequence Similarities
Belongs to the MnmA/TRMU family.
Clinical Relevance
Disease Involvement (2)
Disease variantIntellectual disability
Related Diseases
Supporting Publications2
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |