Protein detail
MPZL1
Myelin protein zero-like protein 1 (Protein zero-related)
Entry name MPZL1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Predicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Myelin protein zero-like protein 1 (Protein zero-related)
Protein Class (2)
Predicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
163..183; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
FLJ21047PZR
Gene Description
Myelin protein zero like 1
Chromosome
1
Position
167721192-167791919
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (3)
Molecular Function (2)
Biological Process (3)
Canonical Pathways (3)
- M3008 Naba ecm glycoproteins
- M5884 Naba core matrisome
- M5889 Naba matrisome
Mediation Categories
Adhesion and uptake mediation
Relations & Evidence47
Enzyme-Mediated Modification (8)
8 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| MPZL1 | SRC | P12931 | Y | 263 | phosphorylation | BEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMLi2012SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:18707149HPRD:19664994ProtMapper:15212693HPRD:18578522KEA:10681522HPRD:11751924ProtMapper:11751924HPRD:20068231KEA:11751924HPRD:18669648HPRD:10681522phosphoELM:11751924HPRD:17016520 |
| MPZL1 | SRC | P12931 | Y | 241 | phosphorylation | BEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:15212693KEA:10681522HPRD:11751924ProtMapper:11751924SIGNOR:11751924KEA:11751924HPRD:20068231HPRD:10681522phosphoELM:11751924 |
| MPZL1 | PTPN11 | Q06124 | Y | 200 | dephosphorylation | HPRD | HPRD:15588985HPRD:9792637 |
| MPZL1 | PTPN11 | Q06124 | Y | 241 | dephosphorylation | HPRDDEPOD | DEPOD:9792637HPRD:11751924HPRD:15588985DEPOD:10681522HPRD:10681522 |
| MPZL1 | PTPN11 | Q06124 | Y | 263 | dephosphorylation | HPRDDEPOD | DEPOD:9792637HPRD:11751924HPRD:15588985DEPOD:10681522HPRD:10681522 |
| MPZL1 | PTPN11 | Q06124 | Y | 263 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:10681522 |
| MPZL1 | INSR | P06213 | Y | 200 | phosphorylation | KEA | KEA:17570479 |
| MPZL1 | LYN | P07948 | Y | 263 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (36)
36 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | Yes | |||
| receptor | receptor | ICELLNET | Yes | Yes | |||
| receptor | receptor | CellChatDB | Yes | Yes | |||
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | CellPhoneDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes |
Page 1 of 4Next
Regulatory Interaction Network (2)
2 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 37338870 |
Sequence, Structure & Domains
Sequences
Length
269
Mass
29,082
Sequence
MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=MPZL1a; IsoId=O95297-1; Sequence=Displayed; Name=2; Synonyms=PZR1a; IsoId=O95297-2; Sequence=VSP_019343; Name=3; Synonyms=PZR1b; IsoId=O95297-3; Sequence=VSP_019344; Name=4; Synonyms=MPZL1b; IsoId=O95297-4; Sequence=VSP_019342; Name=5; IsoId=O95297-5; Sequence=VSP_043341
Alternative Sequence
1..124; Missing (in isoform 4); 42; Missing (in isoform 2); 87..236; Missing (in isoform 5); 203..269; CSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN -> AQSYMHS (in isoform 3)
3D Structural Models
Turn
104..106
Helix
101..103; 113..115; 127..129
Beta Strand
39..41; 44..49; 54..56; 59..61; 67..69; 71..78; 85..91; 94..97; 107..109; 120..124; 131..138; 140..144; 146..155
3D Structure
X-ray crystallography (4)
Domain & Motif Annotations
Compositional Bias
202..211; Polar residues
Motif
239..244; ITIM motif 1; 261..266; ITIM motif 2
Domain (CC)
Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.
Domain (FT)
36..146; Ig-like V-type
Region
199..238; Disordered
Protein Families
Myelin P0 protein family
Sequence Similarities
Belongs to the myelin P0 protein family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32396726 | Plasma-Derived Extracellular Vesicle Phosphoproteomics through Chemical Affinity Purification. | No related sentences available |