Protein detail

MPZL1

Myelin protein zero-like protein 1 (Protein zero-related)

Entry name MPZL1	UniProt ID O95297	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Predicted intracellular proteinsPredicted membrane proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

Myelin protein zero-like protein 1 (Protein zero-related)

Protein Class

Predicted intracellular proteinsPredicted membrane proteins

Protein Function

Predicted intracellular proteins

Transmembrane

163..183; Helical

Transmembrane Count

Ensembl

ENSG00000197965

Entrez Gene Symbol

MPZL1

Gene Synonym

FLJ21047PZR

Gene Description

Myelin protein zero like 1

Chromosome

Position

167721192-167791919

Frequency

EVMP Score

0.50

Fluorescence & Localization

Function & Pathway

Protein Function

Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

Canonical Pathways

M3008 Naba ecm glycoproteins
M5884 Naba core matrisome
M5889 Naba matrisome

Mediation Categories

Adhesion and uptake mediation

Relations & Evidence

Enzyme-Mediated Modification

8 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MPZL1	SRC	P12931	Y	263	phosphorylation	BEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMLi2012SIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	HPRD:18707149 HPRD:19664994 ProtMapper:15212693 HPRD:18578522 KEA:10681522 HPRD:11751924 ProtMapper:11751924 HPRD:20068231 KEA:11751924 HPRD:18669648 HPRD:10681522 phosphoELM:11751924 HPRD:17016520
MPZL1	SRC	P12931	Y	241	phosphorylation	BEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:15212693 KEA:10681522 HPRD:11751924 ProtMapper:11751924 SIGNOR:11751924 KEA:11751924 HPRD:20068231 HPRD:10681522 phosphoELM:11751924
MPZL1	PTPN11	Q06124	Y	200	dephosphorylation	HPRD	HPRD:15588985 HPRD:9792637
MPZL1	PTPN11	Q06124	Y	241	dephosphorylation	HPRDDEPOD	DEPOD:9792637 HPRD:11751924 HPRD:15588985 DEPOD:10681522 HPRD:10681522
MPZL1	PTPN11	Q06124	Y	263	dephosphorylation	HPRDDEPOD	DEPOD:9792637 HPRD:11751924 HPRD:15588985 DEPOD:10681522 HPRD:10681522
MPZL1	PTPN11	Q06124	Y	263	phosphorylation	SIGNOR_ProtMapperProtMapper	ProtMapper:10681522
MPZL1	INSR	P06213	Y	200	phosphorylation	KEA	KEA:17570479
MPZL1	LYN	P07948	Y	263	phosphorylation	KEA	KEA:17570479

Ligand-Receptor Signaling

36 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
adhesion	adhesion	MCAM	Yes	Yes	No	Yes	No
mpz	adhesion	Almen2009	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	No	Yes	No
adhesion	adhesion	OmniPath	Yes	Yes	No	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	CellPhoneDB	No	No	No	Yes	No

Page 2 of 4Previous Next

Regulatory Interaction Network

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PTN11	Q06124	MPZL1	O95297	Yes	No	Yes	WangSIGNORProtMapperDEPODHPRDHINTBioGRIDIntActSIGNOR_ProtMapperHPRD-phosSPIKE_LC	DEPOD:9792637 HPRD-phos:11751924 IntAct:9792637 IntAct:10681522 HINT:9792637 DEPOD:10681522 HPRD-phos:10681522 HPRD-phos:9792637 HPRD:11751924 SIGNOR:10681522 SPIKE_LC:9792637 HPRD:10681522 HPRD:9792637 HINT:33961781 ProtMapper:10681522 HPRD-phos:15588985 BioGRID:9792637 HINT:10681522 SPIKE_LC:16189514
SRC	P12931	MPZL1	O95297	Yes	Yes	No	HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEALi2012HPRDWangPhosphoSite_ProtMapperBEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteSPIKE_LCHPRD-phos	HPRD-phos:18669648 HPRD-phos:11751924 ProtMapper:18707149 phosphoELM:11751924 ProtMapper:15212693 KEA:10681522 ProtMapper:11751924 ProtMapper:17016520 HPRD-phos:18578522 HPRD-phos:20068231 HPRD-phos:10681522 ProtMapper:19664994 PhosphoSite:11751924 HPRD:11751924 KEA:11751924 HPRD:10681522 HPRD-phos:18707149 ProtMapper:10681522 ProtMapper:18578522 SIGNOR:11751924 ProtMapper:20068231 ProtMapper:18669648 HPRD-phos:19664994 HPRD-phos:17016520 SPIKE_LC:16189514

Protein Complex Composition

0 records.

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	37338870

Sequence, Structure & Domains

Sequences

Length

269

Mass

29,082

Sequence

MAASAGAGAVIAAPDSRRWLWSVLAAALGLLTAGVSALEVYTPKEIFVANGTQGKLTCKFKSTSTTGGLTSVSWSFQPEGADTTVSFFHYSQGQVYLGNYPPFKDRISWAGDLDKKDASINIENMQFIHNGTYICDVKNPPDIVVQPGHIRLYVVEKENLPVFPVWVVVGIVTAVVLGLTLLISMILAVLYRRKNSKRDYTGCSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN

Alternative Products

Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=MPZL1a; IsoId=O95297-1; Sequence=Displayed; Name=2; Synonyms=PZR1a; IsoId=O95297-2; Sequence=VSP_019343; Name=3; Synonyms=PZR1b; IsoId=O95297-3; Sequence=VSP_019344; Name=4; Synonyms=MPZL1b; IsoId=O95297-4; Sequence=VSP_019342; Name=5; IsoId=O95297-5; Sequence=VSP_043341

Alternative Sequence

1..124; Missing (in isoform 4); 42; Missing (in isoform 2); 87..236; Missing (in isoform 5); 203..269; CSTSESLSPVKQAPRKSPSDTEGLVKSLPSGSHQGPVIYAQLDHSGGHHSDKINKSESVVYADIRKN -> AQSYMHS (in isoform 3)

3D Structural Models

Turn

104..106

Helix

101..103; 113..115; 127..129

Beta Strand

39..41; 44..49; 54..56; 59..61; 67..69; 71..78; 85..91; 94..97; 107..109; 120..124; 131..138; 140..144; 146..155

3D Structure

X-ray crystallography (4)

Domain & Motif Annotations

Compositional Bias

202..211; Polar residues

Motif

239..244; ITIM motif 1; 261..266; ITIM motif 2

Domain (CC)

Contains 2 copies of a cytoplasmic motif that is referred to as the immunoreceptor tyrosine-based inhibitor motif (ITIM). This motif is involved in modulation of cellular responses. The phosphorylated ITIM motif can bind the SH2 domain of several SH2-containing phosphatases.

Domain (FT)

36..146; Ig-like V-type

Region

199..238; Disordered

Protein Families

Myelin P0 protein family

Sequence Similarities

Belongs to the myelin P0 protein family.

Clinical Relevance

Antibody

HPA026966 HPA063538

Interaction Protein

ENSG00000179295

Interaction Count

Interaction Dataset

intact_biogrid