Protein detail
TM50A
Transmembrane protein 50A (Small membrane protein 1)
Entry name TM50A | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count 4 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
Transmembrane protein 50A (Small membrane protein 1)
Protein Function
Transporters
Transmembrane
26..46; Helical; 58..78; Helical; 95..115; Helical; 126..146; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization5
Tissue SpecificesophagusCell SpecificBasal keratinocytesSingle-Nuclei Brain Specificcentral nervous system macrophageBlood Cell SpecificeosinophilBlood Lineage Specificgranulocytes
Function & Pathway6
Protein Function
Transporters
Cellular Component (4)
Molecular Function
Biological Process (3)
Canonical Pathways
M266 Pid ncadherin pathway
Mediation Categories
Other mediation
Relations & Evidence13
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
Page 1 of 2Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blottingMORPH | 1 | 32089743 |
Sequence, Structure & Domains5
Sequences
Length
157
Mass
17,400
Sequence
MSGFLEGLRCSECIDWGEKRNTIASIAAGVLFFTGWWIIIDAAVIYPTMKDFNHSYHACGVIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFVGFMLAFGSLIASMWILFGGYVAKEKDIVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
Domain & Motif Annotations
Protein Families
UPF0220 family
Sequence Similarities
Belongs to the UPF0220 family.
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |
| 39104279 | A Predictive Model for Initial Platinum-Based Chemotherapy Efficacy in Patients with Postoperative Epithelial Ovarian Cancer Using Tissue-Derived Small Extracellular Vesicles. | No abstract available |