Protein detail
RASN
GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)
Protein symbol RASN | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins |
Basic Information
Protein Names
GTPase NRas (EC 3.6.5.2) (Transforming protein N-Ras)
Protein Class
Cancer-related genesDisease related genesEnzymesHuman disease related genesPotential drug targetsPredicted intracellular proteinsRAS pathway related proteins
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Human disease related genes:Cancers:Head and neck cancers
- Human disease related genes:Cancers:Cancers of the digestive system
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Cancers:Skin cancers
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Human disease related genes:Cancers:Cancers of endocrine organs
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Enzymes
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Human disease related genes:Congenital malformations:Other congenital malformations
- Disease related genes
- Human disease related genes:Cancers:Cancers of soft tissues and bone
Ensembl
Entrez Gene Symbol
Gene Synonym
N-ras
Gene Description
NRAS proto-oncogene, GTPase
Chromosome
1
Position
114704469-114716771
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecifickidneyCell SpecificProximal tubule cells
Function & Pathway
Protein Function
- Cancer-related genes:Mutational cancer driver genes
- Human disease related genes:Cancers:Head and neck cancers
- Human disease related genes:Cancers:Cancers of the digestive system
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Human disease related genes:Cancers:Skin cancers
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Human disease related genes:Cancers:Cancers of endocrine organs
- Potential drug targets
- RAS pathway related proteins
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Enzymes
- Human disease related genes:Cancers:Cancers of haematopoietic and lymphoid tissues
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- ENZYME proteins:Hydrolases
- Human disease related genes:Congenital malformations:Other congenital malformations
- Disease related genes
- Human disease related genes:Cancers:Cancers of soft tissues and bone
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa01521 EGFR tyrosine kinase inhibitor resistance
- KEGG:hsa01522 Endocrine resistance
- KEGG:hsa04010 MAPK signaling pathway
- KEGG:hsa04012 ErbB signaling pathway
- KEGG:hsa04014 Ras signaling pathway
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04062 Chemokine signaling pathway
- KEGG:hsa04068 FoxO signaling pathway
- KEGG:hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04137 Mitophagy - animal
- KEGG:hsa04140 Autophagy - animal
- KEGG:hsa04150 mTOR signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04210 Apoptosis
- KEGG:hsa04211 Longevity regulating pathway
- KEGG:hsa04213 Longevity regulating pathway - multiple species
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04370 VEGF signaling pathway
- KEGG:hsa04371 Apelin signaling pathway
- KEGG:hsa04519 Cadherin signaling
- KEGG:hsa04540 Gap junction
- KEGG:hsa04550 Signaling pathways regulating pluripotency of stem cells
- KEGG:hsa04625 C-type lectin receptor signaling pathway
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04662 B cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04714 Thermogenesis
- KEGG:hsa04720 Long-term potentiation
- KEGG:hsa04722 Neurotrophin signaling pathway
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04910 Insulin signaling pathway
- KEGG:hsa04912 GnRH signaling pathway
- KEGG:hsa04915 Estrogen signaling pathway
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04917 Prolactin signaling pathway
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa04929 GnRH secretion
- KEGG:hsa04933 AGE-RAGE signaling pathway in diabetic complications
- KEGG:hsa04935 Growth hormone synthesis, secretion and action
- KEGG:hsa05010 Alzheimer disease
- KEGG:hsa05022 Pathways of neurodegeneration - multiple diseases
- KEGG:hsa05034 Alcoholism
- KEGG:hsa05160 Hepatitis C
- KEGG:hsa05161 Hepatitis B
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05203 Viral carcinogenesis
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05206 MicroRNAs in cancer
- KEGG:hsa05207 Chemical carcinogenesis - receptor activation
- KEGG:hsa05208 Chemical carcinogenesis - reactive oxygen species
- KEGG:hsa05210 Colorectal cancer
- KEGG:hsa05211 Renal cell carcinoma
- KEGG:hsa05213 Endometrial cancer
- KEGG:hsa05214 Glioma
- KEGG:hsa05215 Prostate cancer
- KEGG:hsa05216 Thyroid cancer
- KEGG:hsa05218 Melanoma
- KEGG:hsa05219 Bladder cancer
- KEGG:hsa05220 Chronic myeloid leukemia
- KEGG:hsa05221 Acute myeloid leukemia
- KEGG:hsa05223 Non-small cell lung cancer
- KEGG:hsa05224 Breast cancer
- KEGG:hsa05225 Hepatocellular carcinoma
- KEGG:hsa05226 Gastric cancer
- KEGG:hsa05230 Central carbon metabolism in cancer
- KEGG:hsa05231 Choline metabolism in cancer
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-9028731 activated ntrk2 signals through frs2 and frs3
- R-hsa-9026519 activated ntrk2 signals through ras
- R-hsa-9034864 activated ntrk3 signals through ras
- R-hsa-442755 activation of nmda receptors and postsynaptic events
- R-hsa-1169092 activation of ras in b cells
- R-hsa-1280218 adaptive immune system
- R-hsa-5621575 cd209 dc sign signaling
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-5637810 constitutive signaling by egfrviii
- R-hsa-1236382 constitutive signaling by ligand responsive egfr cancer variants
- R-hsa-9634285 constitutive signaling by overexpressed erbb2
- R-hsa-442742 creb1 phosphorylation through nmda receptor mediated activation of ras signaling
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-1168372 downstream signaling events of b cell receptor bcr
- R-hsa-5654687 downstream signaling of activated fgfr1
- R-hsa-5654696 downstream signaling of activated fgfr2
- R-hsa-5654708 downstream signaling of activated fgfr3
- R-hsa-5654716 downstream signaling of activated fgfr4
- R-hsa-186763 downstream signal transduction
- R-hsa-2179392 egfr transactivation by gastrin
- R-hsa-9027284 erythropoietin activates ras
- R-hsa-8939211 esr mediated signaling
- R-hsa-9634635 estrogen stimulated signaling through prkcz
- R-hsa-9009391 extra nuclear estrogen signaling
- R-hsa-2871796 fceri mediated mapk activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-9607240 flt3 signaling
- R-hsa-9682385 flt3 signaling in disease
- R-hsa-5654693 frs mediated fgfr1 signaling
- R-hsa-5654700 frs mediated fgfr2 signaling
- R-hsa-5654706 frs mediated fgfr3 signaling
- R-hsa-5654712 frs mediated fgfr4 signaling
- R-hsa-881907 gastrin creb signalling pathway via pkc and mapk
- R-hsa-1963640 grb2 events in erbb2 signaling
- R-hsa-416476 g alpha q signalling events
- R-hsa-109582 hemostasis
- R-hsa-168249 innate immune system
- R-hsa-74751 insulin receptor signalling cascade
- R-hsa-112399 irs mediated signalling
- R-hsa-5674135 map2k and mapk activation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-8851805 met activates ras signaling
- R-hsa-375165 ncam signaling for neurite out growth
- R-hsa-5675221 negative regulation of mapk pathway
- R-hsa-9675108 nervous system development
- R-hsa-112316 neuronal system
- R-hsa-112314 neurotransmitter receptors and postsynaptic signal transmission
- R-hsa-6798695 neutrophil degranulation
- R-hsa-6802957 oncogenic mapk signaling
- R-hsa-171007 p38mapk events
- R-hsa-8849471 ptk6 regulates rho gtpases ras gtpase and map kinases
- R-hsa-5673000 raf activation
- R-hsa-442982 ras activation upon ca2 influx through nmda receptor
- R-hsa-9648002 ras processing
- R-hsa-6802953 ras signaling downstream of nf1 loss of function variants
- R-hsa-5658442 regulation of ras by gaps
- R-hsa-180336 shc1 events in egfr signaling
- R-hsa-1250196 shc1 events in erbb2 signaling
- R-hsa-1250347 shc1 events in erbb4 signaling
- R-hsa-5654688 shc mediated cascade fgfr1
- R-hsa-5654704 shc mediated cascade fgfr3
- R-hsa-5654719 shc mediated cascade fgfr4
- R-hsa-2428933 shc related events triggered by igf1r
- R-hsa-6802952 signaling by braf and raf1 fusions
- R-hsa-177929 signaling by egfr
- R-hsa-1643713 signaling by egfr in cancer
- R-hsa-1227986 signaling by erbb2
- R-hsa-9665348 signaling by erbb2 ecd mutants
- R-hsa-1227990 signaling by erbb2 in cancer
- R-hsa-1236394 signaling by erbb4
- R-hsa-9006335 signaling by erythropoietin
- R-hsa-190236 signaling by fgfr
- R-hsa-5654736 signaling by fgfr1
- R-hsa-5655302 signaling by fgfr1 in disease
- R-hsa-5654738 signaling by fgfr2
- R-hsa-5655253 signaling by fgfr2 in disease
- R-hsa-5654741 signaling by fgfr3
- R-hsa-5654743 signaling by fgfr4
- R-hsa-5655291 signaling by fgfr4 in disease
- R-hsa-1226099 signaling by fgfr in disease
- R-hsa-9703465 signaling by flt3 fusion proteins
- R-hsa-9703648 signaling by flt3 itd and tkd mutants
- R-hsa-372790 signaling by gpcr
- R-hsa-74752 signaling by insulin receptor
- R-hsa-9669938 signaling by kit in disease
- R-hsa-6806834 signaling by met
- R-hsa-6802946 signaling by moderate kinase activity braf mutants
- R-hsa-9006115 signaling by ntrk2 trkb
- R-hsa-9034015 signaling by ntrk3 trkc
- R-hsa-166520 signaling by ntrks
- R-hsa-9006931 signaling by nuclear receptors
- R-hsa-186797 signaling by pdgf
- R-hsa-9673767 signaling by pdgfra transmembrane juxtamembrane and kinase domain mutants
- R-hsa-9671555 signaling by pdgfr in disease
- R-hsa-8848021 signaling by ptk6
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-1433557 signaling by scf kit
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-2404192 signaling by type 1 insulin like growth factor 1 receptor igf1r
- R-hsa-194138 signaling by vegf
- R-hsa-187687 signalling to erks
- R-hsa-167044 signalling to ras
- R-hsa-112412 sos mediated signalling
- R-hsa-210993 tie2 signaling
- R-hsa-112315 transmission across chemical synapses
- R-hsa-5218921 vegfr2 mediated cell proliferation
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NRAS | STK19 | P49842 | S | 89 | phosphorylation | PhosphoSiteSIGNOR | SIGNOR:30712867 |
| NRAS | PTPN11 | Q06124 | Y | 32 | dephosphorylation | SIGNOR | SIGNOR:26617336 |
| NRAS | PTPN11 | Q06124 | Y | 32 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:26617336 |
| NRAS | SRC | P12931 | Y | 32 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper |
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
Regulatory Interaction Network
18 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| RASN | P01111 | PK3CB | P42338 | Yes | Yes | No | KEGG-MEDICUSWangSIGNOR | SIGNOR:21779497 |
| PTN11 | Q06124 | RASN | P01111 | Yes | Yes | No | WangSIGNOR_ProtMapperSIGNORProtMapper | ProtMapper:26617336SIGNOR:26617336 |
| RASN | P01111 | ARAF | P10398 | Yes | Yes | No | KEGG-MEDICUSWangHINTSIGNOR | SIGNOR:21779497HINT:34591642 |
| RASN | P01111 | PK3CG | P48736 | Yes | Yes | No | WangSIGNOR | SIGNOR:21779497 |
| DAB2P | Q5VWQ8 | RASN | P01111 | Yes | No | Yes | SIGNOR | SIGNOR:27858941 |
| RPGF5 | Q92565 | RASN | P01111 | Yes | Yes | No | SIGNOR | SIGNOR:19201597 |
| RGF1C | Q8N431 | RASN | P01111 | Yes | Yes | No | SIGNOR | SIGNOR:19201597 |
| RGF1A | Q8N9B8 | RASN | P01111 | Yes | Yes | No | SIGNOR | SIGNOR:19201597 |
Page 2 of 2Previous
Protein Complex Composition
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| KRASNRASRAP1GDS1RASGRF2UBCZDHHC9 | O14827P01111P01116P0CG48P52306Q9Y397 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8870 | ||
| ABL1HRASKRASNRASRIN1 | P00519P01111P01112P01116Q13671 | 0:0:0:0:0 | hu.MAP2 | |||
| ABHD5ABL1HRASKRASNRASRIN1 | P00519P01111P01112P01116Q13671Q8WTS1 | 0:0:0:0:0:0 | hu.MAP2 | |||
| NRAS | P01111 | 2 | PDB | PDB:6zizPDB:6wghPDB:8vm2PDB:6zio | ||
| NRASPPIA | P01111P62937 | 2:2 | PDB | PDB:9bg0PDB:9bgdPDB:9bg3PDB:9bg8PDB:8tbi | ||
| ABHD5NRAS | P01111Q8WTS1 | 0:0 | hu.MAP2 | |||
| NRASSHOC2 | P01111Q9UQ13 | 1:1 | PDB | PDB:9btm |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37922300 |
Sequence, Structure & Domains
Sequences
Length
189
Mass
21,229
Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQGCMGLPCVVM
3D Structural Models
Turn
146..148
Helix
16..25; 62..67; 68..74; 84..86; 88..90; 91..104; 124..137; 152..168
Beta Strand
2..9; 36..46; 49..58; 76..83; 111..116; 141..143
3D Structure
NMR spectroscopy (2); X-ray crystallography (25)
Domain & Motif Annotations
Motif
32..40; Effector region
Region
166..185; Hypervariable region
Protein Families
- Small GTPase superfamily
- Ras family
Sequence Similarities
Belongs to the small GTPase superfamily. Ras family.
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantProto-oncogene
Related Diseases
Biomarker
Phase 2; Investigative
Drugs
AZACITIDINECARBOPLATINGANITUMABFUTUXIMAB/MODOTUXIMAB MIXTUREINOSITOLBRAF INHIBITOR BGB-3245NULLSELUMETINIBKO-947NIVOLUMABNAVITOCLAXSOTORASIBAKT INHIBITOR MK2206CCT196969P53-HDM2 INTERACTION INHIBITOR MI-773INFIGRATINIBCETUXIMABTRAMETINIB DIMETHYL SULFOXIDEEXARAFENIBRIBOCICLIBQUIZARTINIBPEMBROLIZUMABVEMURAFENIBDABRAFENIBIPILIMUMABADAVOSERTIBANTI-CD19 CAR T CELLS PREPARATIONAZ628GI-4000GDC-0879MITOGEN-ACTIVATED PROTEIN KINASE KINASE INHIBITORCYTARABINEYM-254890GEDATOLISIBBI-847325TAK-632MEK 1/2 INHIBITOR FCN-159TAK-733EVEROLIMUSE6201IRINOTECAN HYDROCHLORIDEREFAMETINIBOBATOCLAXALPELISIBPANITUMUMABRIGOSERTIBCERITINIBTIZATERKIBHSP90 INHIBITOR XL888ABEMACICLIBTORIPALIMAB-TPZIPF-4708671SALIRASIBALTEPLASEIODINE I 131-6-BETA-IODOMETHYL-19-NORCHOLESTEROLBUPARLISIBOMIPALISIBPLX-4720PIMASERTIBTUNLAMETINIBBELVARAFENIBRUCAPARIBCHELIDONINERINETERKIBFLUOROURACILTEMUTERKIBDUBERMATINIBSORAFENIBFORETINIBSCH772984BIVALENT BRD4 INHIBITOR AZD5153EG5 KINESIN-RELATED MOTOR PROTEIN INHIBITOR 4SC-205RECOMBINANT INTERFERONPELAREOREPNAPORAFENIBTUBASTATIN AERK INHIBITOR CC-90003KRAS G12D INHIBITOR MRTX1133GILTERITINIBCOPANLISIBBI-3406METFORMINCHLOROQUINEDACTOLISIBBINIMETINIBTIVOZANIBCOBIMETINIBULIXERTINIBERK1/2 INHIBITOR ERAS-007LORLATINIBTALAZOPARIBPAZOPANIBREGORAFENIBVENETOCLAXLENVATINIBOLAPARIBMK-8353FF-10101GEMCITABINEB-RAF/VEGFR-2 INHIBITOR RAF265ASTX029GDC-0623OSIMERTINIBMEK INHIBITOR IMM-1-104ENCORAFENIBLIFIRAFENIBI-BET151PALBOCICLIBSINTILIMABDEL-22379LY3009120LEUCOVORIN CALCIUMOPNURASIBMETHYLNITROSOUREATUCATINIBFUTIBATINIBCABOZANTINIB S-MALATECCT241161MIRDAMETINIBSIROLIMUSLYMPHOKINE-ACTIVATED KILLER CELLSCISPLATINICOVAMENIBAVUTOMETINIBPLX8394
Interaction Protein
ENSG00000132155ENSG00000157764ENSG00000174791
Interaction Count
3
Interaction Dataset
intact_biogrid