Protein detail
THY1
Thy-1 membrane glycoprotein (CDw90) (Thy-1 antigen) (CD antigen CD90)
Entry name THY1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 2 | Transmembrane count | Protein classification CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Thy-1 membrane glycoprotein (CDw90) (Thy-1 antigen) (CD antigen CD90)
Protein Class (4)
CD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
CD90
Gene Description
Thy-1 cell surface antigen
Chromosome
11
Position
119415476-119424985
Supporting publications (n)
2
EVMP confidence score
0.38
Fluorescence & Localization7
Tissue SpecifickidneyBrain Regional Specificchoroid plexusCell SpecificBreast secretory cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellSecretome LocationIntracellular and membraneSecretome FunctionTransport
Function & Pathway8
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (17)
- GO:0005576 extracellular region
- GO:0005783 endoplasmic reticulum
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0016324 apical plasma membrane
- GO:0030425 dendrite
- GO:0030426 growth cone
- GO:0030673 axolemma
Page 1 of 2
Molecular Function (4)
Biological Process (3)
Reactome (2)
Canonical Pathways
M53 Pid integrin3 pathway
Mediation Categories (5)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence42
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | Yes |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | Yes |
| matrix_adhesion | matrix_adhesion | OmniPath | No | Yes | No | No | Yes |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | No | Yes |
| transmembrane | transmembrane | TopDB | No | No | No | No | Yes |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | Yes |
| transmembrane | transmembrane | OmniPath | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blotting | 1 | 37922300 |
Sequence, Structure & Domains4
Sequences
Length
161
Mass
17,935
Sequence
MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL
Domain & Motif Annotations
Domain (FT)
20..126; Ig-like V-type
Clinical Relevance2
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 29603567 | Involvement of serum-derived exosomes of elderly patients with bone loss in failure of bone remodeling via alteration of exosomal bone-related proteins. | No abstract available |
| 31753726 | Serum extracellular vesicles contain SPARC and LRG1 as biomarkers of colon cancer and differ by tumour primary location. | No abstract available |