Protein detail

GLPC

Glycophorin-C (Glycoconnectin) (Glycophorin-D) (GPD) (Glycoprotein beta) (PAS-2') (Sialoglycoprotein D) (CD antigen CD236)

Entry name GLPC	UniProt ID P04921	EVMP confidence score 0.72
Supporting publications (n) 11	Transmembrane count 1	Protein classification Blood group antigen proteinsCD markersPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Glycophorin-C (Glycoconnectin) (Glycophorin-D) (GPD) (Glycoprotein beta) (PAS-2') (Sialoglycoprotein D) (CD antigen CD236)

Protein Class (3)

Blood group antigen proteinsCD markersPredicted membrane proteins

Protein Function (2)

Blood group antigen proteins
CD markers

Transmembrane

58..81; Helical; Signal-anchor for type III membrane protein

Transmembrane Count

Ensembl

ENSG00000136732

Entrez Gene Symbol

GYPC

Gene Synonym (5)

CD236CD236RGeGPCGYPD

Gene Description

Glycophorin C (Gerbich blood group)

Chromosome

Position

126656133-126696667

Supporting publications (n)

EVMP confidence score

0.72

Fluorescence & Localization1

Cell SpecificAlveolar cells type 2

Function & Pathway7

Protein Function (2)

Blood group antigen proteins
CD markers

Cellular Component (3)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG

hsa05144 Malaria

Reactome (2)

Mediation Categories (2)

Fusion and delivery mediationImmune mediation

Relations & Evidence23

Ligand-Receptor Signaling (22)

22 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane_sosui	transmembrane_predicted	Almen2009	No	No	No	Yes	No
transmembrane_tmhmm	transmembrane_predicted	Almen2009	No	No	No	Yes	No

Page 3 of 3Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometryWestern blotting	14	32195353 32013145 31485223 31048929 30982971 30890157 29723143 33773551 22728313 25388097 25544774 27419629 36613908 38139054

Sequence, Structure & Domains10

Sequences

Length

128

Mass

13,811

Sequence

MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=Glycophorin-C; IsoId=P04921-1; Sequence=Displayed; Name=Glycophorin-D; IsoId=P04921-2; Sequence=VSP_001777; Name=3; Synonyms=IsoGPC; IsoId=P04921-3; Sequence=VSP_054790

Alternative Sequence

1..21; Missing (in isoform Glycophorin-D); 18..36; Missing (in isoform 3)

3D Structural Models

3D Structure

NMR spectroscopy (1)

Domain & Motif Annotations

Compositional Bias

1..12; Polar residues; 22..33; Low complexity

Region

1..48; Disordered; 108..128; Disordered

Protein Families

Glycophorin-C family

Sequence Similarities

Belongs to the glycophorin-C family.

Clinical Relevance2

Drugs (3)

IBALIZUMAB TREGALIZUMAB DOCOSANOL

Antibody (2)

HPA008965 CAB009445

Supporting Publications11

PMID	Title	Abstract
32854315	Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study.	Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD.
33905554	Proteomic analysis of extracellular vesicles identified PI3K pathway as a potential therapeutic target for cabazitaxel-resistant prostate cancer.	No abstract available
34576246	Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators.	No abstract available
37204515	Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma.	No abstract available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No abstract available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No abstract available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No abstract available
38607062	Enrichment, Characterization, and Proteomic Profiling of Small Extracellular Vesicles Derived from Human Limbal Mesenchymal Stromal Cells and Melanocytes.	No abstract available
39001700	Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles.	No abstract available
41068253	Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression.	No abstract available

Page 1 of 2Next