Protein detail
GLPC
Glycophorin-C (Glycoconnectin) (Glycophorin-D) (GPD) (Glycoprotein beta) (PAS-2') (Sialoglycoprotein D) (CD antigen CD236)
Entry name GLPC | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 11 | Transmembrane count 1 | Protein classification Blood group antigen proteinsCD markersPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Glycophorin-C (Glycoconnectin) (Glycophorin-D) (GPD) (Glycoprotein beta) (PAS-2') (Sialoglycoprotein D) (CD antigen CD236)
Protein Class (3)
Blood group antigen proteinsCD markersPredicted membrane proteins
Protein Function (2)
- Blood group antigen proteins
- CD markers
Transmembrane
58..81; Helical; Signal-anchor for type III membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD236CD236RGeGPCGYPD
Gene Description
Glycophorin C (Gerbich blood group)
Chromosome
2
Position
126656133-126696667
Supporting publications (n)
11
EVMP confidence score
0.72
Fluorescence & Localization
Cell SpecificAlveolar cells type 2
Function & Pathway
Protein Function (2)
- Blood group antigen proteins
- CD markers
Cellular Component (3)
Molecular Function
Biological Process (3)
KEGG
Mediation Categories (2)
Fusion and delivery mediationImmune mediation
Relations & Evidence23
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes | ||||
| cell_surface | cell_surface | Surfaceome | Yes | ||||
| cell_surface | cell_surface | OmniPath | Yes | ||||
| transmembrane | transmembrane_predicted | Phobius | Yes | ||||
| transmembrane_phobius | transmembrane_predicted | Almen2009 | Yes |
Isolation & Detection Technology (1)
Sequence, Structure & Domains
Sequences
Length
128
Mass
13,811
Sequence
MWSTRSPNSTAWPLSLEPDPGMASASTTMHTTTIAEPDPGMSGWPDGRMETSTPTIMDIVVIAGVIAAVAIVLVSLLFVMLRYMYRHKGTYHTNEAKGTEFAESADAALQGDPALQDAGDSSRKEYFI
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=Glycophorin-C; IsoId=P04921-1; Sequence=Displayed; Name=Glycophorin-D; IsoId=P04921-2; Sequence=VSP_001777; Name=3; Synonyms=IsoGPC; IsoId=P04921-3; Sequence=VSP_054790
Alternative Sequence
1..21; Missing (in isoform Glycophorin-D); 18..36; Missing (in isoform 3)
3D Structural Models
3D Structure
NMR spectroscopy (1)
Domain & Motif Annotations
Compositional Bias
1..12; Polar residues; 22..33; Low complexity
Region
1..48; Disordered; 108..128; Disordered
Protein Families
Glycophorin-C family
Sequence Similarities
Belongs to the glycophorin-C family.
Clinical Relevance
Drugs (3)
Supporting Publications11
| PMID | Title | Related sentences |
|---|---|---|
| 32854315 | Proteomic Profiling of Extracellular Vesicles Derived from Cerebrospinal Fluid of Alzheimer's Disease Patients: A Pilot Study. | Recent studies have highlighted the importance of Aβ and tau-containing extracellular vesicles (EVs) in AD. |
| 33905554 | Proteomic analysis of extracellular vesicles identified PI3K pathway as a potential therapeutic target for cabazitaxel-resistant prostate cancer. | No related sentences available |
| 34576246 | Burn Injury Induces Proinflammatory Plasma Extracellular Vesicles That Associate with Length of Hospital Stay in Women: CRP and SAA1 as Potential Prognostic Indicators. | No related sentences available |
| 37204515 | Proteomic profiling and functional characterization of serum-derived extracellular vesicles in the mucinous and non-mucinous colon adenocarcinoma. | No related sentences available |
| 37322475 | Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 38207106 | Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity. | No related sentences available |
| 38607062 | Enrichment, Characterization, and Proteomic Profiling of Small Extracellular Vesicles Derived from Human Limbal Mesenchymal Stromal Cells and Melanocytes. | No related sentences available |
| 39001700 | Optimized AF4 combined with density cushion ultracentrifugation enables profiling of high-purity human blood extracellular vesicles. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |
Page 1 of 2Next