Protein detail
APOD
Apolipoprotein D (Apo-D) (ApoD)
Entry name APOD | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 7 | Transmembrane count | Protein classification Cancer-related genesCandidate cardiovascular disease genesPlasma proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Apolipoprotein D (Apo-D) (ApoD)
Protein Class (4)
Cancer-related genesCandidate cardiovascular disease genesPlasma proteinsPredicted secreted proteins
Protein Function (3)
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
Apo-D
Gene Description
Apolipoprotein D
Chromosome
3
Position
195568705-195584033
Supporting publications (n)
7
EVMP confidence score
0.63
Fluorescence & Localization
Tissue Specificadipose tissueBrain Regional Specificbasal gangliaCell SpecificEpicardial cellsSingle-Nuclei Brain SpecificleukocyteBlood Cell Specificintermediate monocyteBlood Lineage Specificmonocytes
Function & Pathway
Protein Function (3)
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
Cellular Component (9)
Molecular Function (3)
Biological Process (3)
Reactome (7)
- R-hsa-9024446 nr1h2 and nr1h3 mediated signaling
- R-hsa-9029569 nr1h3 nr1h2 regulate gene expression linked to cholesterol transport and efflux
- R-hsa-9006931 signaling by nuclear receptors
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-804914 transport of fatty acids
- R-hsa-382551 transport of small molecules
- R-hsa-425397 transport of vitamins nucleosides and related molecules
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence25
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | connectomeDB2020 | Yes | ||||
| secreted | secreted | Baccin2019 | Yes | ||||
| secreted | secreted | Cellinker | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | talklr | Yes | Yes | |||
| ligand | ligand | Cellinker | Yes | Yes | |||
| ligand | ligand | connectomeDB2020 | Yes | Yes | |||
| ligand | ligand | iTALK | Yes | Yes | |||
| ligand | ligand | EMBRACE | Yes | Yes | |||
| ligand | ligand | CellTalkDB | Yes | Yes |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | ELISA | 1 | 26775013 |
Sequence, Structure & Domains
Sequences
Length
189
Mass
21,276
Sequence
MVMLLLLLSALAGLFGAAEGQAFHLGKCPNPPVQENFDVNKYLGRWYEIEKIPTTFENGRCIQANYSLMENGKIKVLNQELRADGTVNQIEGEATPVNLTEPAKLEVKFSWFMPSAPYWILATDYENYALVYSCTCIIQLFHVDFAWILARNPNLPPETVDSLKNILTSNNIDVKKMTVTDQVNCPKLS
3D Structural Models
Helix
39..41; 157..169
Beta Strand
24..27; 44..51; 60..68; 74..81; 87..97; 104..108; 116..123; 125..138; 141..153; 183..185
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Protein Families (2)
- Calycin superfamily
- Lipocalin family
Sequence Similarities
Belongs to the calycin superfamily. Lipocalin family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Antibody
Supporting Publications7
| PMID | Title | Related sentences |
|---|---|---|
| 37427430 | Multiomics of Tissue Extracellular Vesicles Identifies Unique Modulators of Atherosclerosis and Calcific Aortic Valve Stenosis. | No related sentences available |
| 38037300 | Proteomic profiling of paired human liver homogenate and tissue derived extracellular vesicles. | No related sentences available |
| 39408670 | Proteomic Characterization of Corneal Epithelial and Stromal Cell-Derived Extracellular Vesicles. | No related sentences available |
| 39702169 | iTRAQ proteomic analysis of exosomes derived from synovial fluid reveals disease patterns and potential biomarkers of Osteoarthritis. | No related sentences available |
| 39778061 | Proteomic Analysis of Plasma Exosomes Enables the Identification of Lung Cancer in Patients With Chronic Obstructive Pulmonary Disease. | No related sentences available |
| 40596376 | Proteomic profiling of plasma extracellular vesicles identifies signatures of innate immunity, coagulation, and endothelial activation in septic patients. | No related sentences available |
| 40689422 | Defining the Ovarian Cancer Precancerous Landscape through Modeling Fallopian Tube Epithelium Reprogramming Driven by Extracellular Vesicles. | No related sentences available |