Protein detail

PPBT

Alkaline phosphatase, tissue-nonspecific isozyme (AP-TNAP) (TNS-ALP) (TNSALP) (EC 3.1.3.1) (Alkaline phosphatase liver/bone/kidney isozyme) (Phosphoamidase) (Phosphocreatine phosphatase) (EC 3.9.1.1)

Entry name PPBT	UniProt ID P05186	EVMP confidence score 0.47
Supporting publications (n) 13	Transmembrane count	Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins

Basic Information

Protein Names

Alkaline phosphatase, tissue-nonspecific isozyme (AP-TNAP) (TNS-ALP) (TNSALP) (EC 3.1.3.1) (Alkaline phosphatase liver/bone/kidney isozyme) (Phosphoamidase) (Phosphocreatine phosphatase) (EC 3.9.1.1)

Protein Class (9)

Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPlasma proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of cofactor/vitamin metabolism
Predicted intracellular proteins
Potential drug targets
Enzymes
Cancer-related genes:Candidate cancer biomarkers
ENZYME proteins:Hydrolases
Disease related genes

Ensembl

ENSG00000162551

Entrez Gene Symbol

ALPL

Gene Synonym (4)

HOPSTNALPTNAPTNSALP

Gene Description

Alkaline phosphatase, biomineralization associated

Chromosome

Position

21509397-21578410

Supporting publications (n)

EVMP confidence score

0.47

Fluorescence & Localization

Tissue SpecifictestisCell SpecificEarly primary spermatocytes

Function & Pathway

Protein Function (7)

Human disease related genes:Congenital disorders of metabolism:Congenital disorders of cofactor/vitamin metabolism
Predicted intracellular proteins
Potential drug targets
Enzymes
Cancer-related genes:Candidate cancer biomarkers
ENZYME proteins:Hydrolases
Disease related genes

Cellular Component (8)

Molecular Function (9)

Biological Process (3)

KEGG (4)

Reactome (2)

Mediation Categories (3)

Clinical-translation mediationImmune mediationMetabolism mediation

Relations & Evidence25

Ligand-Receptor Signaling (19)

19 records.

Category	Parent	Database	Plasma Membrane (Peripheral)
transmembrane	transmembrane	OmniPath	Yes
peripheral	peripheral	UniProt_location	Yes
peripheral	peripheral	OmniPath	Yes
plasma_membrane	plasma_membrane	UniProt_location	Yes
plasma_membrane	plasma_membrane	OmniPath	Yes
plasma_membrane_peripheral	plasma_membrane_peripheral	CSPA	Yes
plasma_membrane_peripheral	plasma_membrane_peripheral	OmniPath	Yes
cell_surface	cell_surface	Surfaceome	Yes
cell_surface	cell_surface	OmniPath	Yes

Page 2 of 2Previous

Regulatory Interaction Network (2)

2 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
PPBT	P05186	TAU	P10636	Yes		Yes	SIGNOR	SIGNOR:24646911
PPBT	P05186	OSTP	P10451	Yes		Yes	SIGNOR	SIGNOR:23427088

Protein Complex Composition (3)

3 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ALPL EIF3A EIF3B EIF3F EIF3H EIF3I EIF3J EIF4A1 EIF4A2 EIF4E EIF4G1 EIF4G2 EIF4G3 PABPC1 SUMO1	O00303 O15372 O43432 O75822 P05186 P06730 P11940 P55884 P60842 P63165 P78344 Q04637 Q13347 Q14152 Q14240	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7035
ALPL	P05186	8	PDB	PDB:7yiwPDB:7yixPDB:7yiv
ALPL BIRC3 BIRC6 BIRC7 CASP9 CDC23	P05186 P55211 Q13489 Q96CA5 Q9NR09 Q9UJX2	1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9558

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Western blottingFlow cytometryMORPH	3	32218180 33709510 32089743

Sequence, Structure & Domains

Sequences

Length

524

Mass

57,305

Sequence

MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCGVKANEGTVGVSAATERSRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAHSADRDWYSDNEMPPEALSQGCKDIAYQLMHNIRDIDVIMGGGRKYMYPKNKTDVEYESDEKARGTRLDGLDLVDTWKSFKPRYKHSHFIWNRTELLTLDPHNVDYLLGLFEPGDMQYELNRNNVTDPSLSEMVVVAIQILRKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDRAIGQAGSLTSSEDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMLSDTDKKPFTAILYGNGPGYKVVGGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFSKGPMAHLLHGVHEQNYVPHVMAYAACIGANLGHCAPASSAGSLAAGPLLLALALYPLSVLF

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P05186-1; Sequence=Displayed; Name=2; IsoId=P05186-2; Sequence=VSP_042711; Name=3; IsoId=P05186-3; Sequence=VSP_044228

Alternative Sequence

1..99; MISPFLVLAIGTCLTNSLVPEKEKDPKYWRDQAQETLKYALELQKLNTNVAKNVIMFLGDGMGVSTVTAARILKGQLHHNPGEETRLEMDKFPFVALSK -> MPWSFRSSTPTWLRMSSCSWEM (in isoform 2); 1..55; Missing (in isoform 3)

3D Structural Models

Turn

88..91; 176..178; 189..191; 303..305; 404..406

Helix

21..24; 26..42; 65..77; 111..119; 139..141; 150..156; 172..175; 194..198; 204..210; 252..257; 272..277; 280..282; 298..300; 309..320; 335..342; 345..365; 431..433; 468..470; 477..479; 480..487; 495..497

Beta Strand

52..59; 93..99; 103..107; 128..130; 160..168; 217..221; 224..228; 240..243; 246..248; 284..289; 291..294; 327..333; 370..378; 383..385; 411..418; 445..448; 459..465; 473..476

3D Structure

Electron microscopy (1); X-ray crystallography (2)

Domain & Motif Annotations

Domain (CC)

Calcium-binding is structural and does not influence the alkaline phosphatase activity (PubMed:25775211). At very high concentrations, calcium can however substitute for zinc at zinc-binding sites, leading to strongly reduced enzyme activity (PubMed:25775211).

Protein Families

Alkaline phosphatase family

Sequence Similarities

Belongs to the alkaline phosphatase family.

Clinical Relevance

Disease Involvement (2)

Cancer-related genesDisease variant

Related Diseases (5)

Colon cancer Genetic prion disease Mineral absorption/transport disorder Parasitic infection Pseudoxanthoma elasticum

Biomarker

Withdrawn from market; Approved; Phase 1; Phase 2

Antibody (3)

HPA007105 HPA008765 CAB020829

Supporting Publications13

PMID	Title	Related sentences
26826536	[Cardiovascular risk study in patients with renin-angiotensin system blockade by means of the proteone of circulating extracellular vesicles].	No related sentences available
27821849	Detailed Analysis of Protein Topology of Extracellular Vesicles-Evidence of Unconventional Membrane Protein Orientation.	No related sentences available
34064677	Ubiquinone Metabolism and Transcription HIF-1 Targets Pathway Are Toxicity Signature Pathways Present in Extracellular Vesicles of Paraquat-Exposed Human Brain Microvascular Endothelial Cells.	No related sentences available
35119778	Optimization of small extracellular vesicle isolation from expressed prostatic secretions in urine for in-depth proteomic analysis.	No related sentences available
36064647	Systemic proteomics and miRNA profile analysis of exosomes derived from human pluripotent stem cells.	No related sentences available
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No related sentences available
37322475	Comprehensive profiling of extracellular vesicles in uveitis and scleritis enables biomarker discovery and mechanism exploration.	No related sentences available
37926756	Extracellular vesicles from non-neuroendocrine SCLC cells promote adhesion and survival of neuroendocrine SCLC cells.	No related sentences available
38113368	In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum.	No related sentences available
38207106	Proteomic, Metabolomic, and Fatty Acid Profiling of Small Extracellular Vesicles from Glioblastoma Stem-Like Cells and Their Role in Tumor Heterogeneity.	No related sentences available

Page 1 of 2Next