Protein detail

S10A9

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Entry name
S10A9
UniProt ID
EVMP confidence score
0.72
Supporting publications (n)
19
Transmembrane count
Protein classification
Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information11
Protein Names
Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein Class (4)
Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Predicted intracellular proteins
Entrez Gene Symbol
Gene Synonym (12)
60B8AGCAGBCFAGCGLBLIAGMAC387MIFMRP-14MRP14NIFP14S100-A9
Gene Description
S100 calcium binding protein A9
Chromosome
1
Position
153357854-153361023
Supporting publications (n)
19
EVMP confidence score
0.72
Fluorescence & Localization4
Tissue SpecificintestineCell SpecificColonocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Predicted intracellular proteins
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence36

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
S100A9MAPK14Q16539T113phosphorylationphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (26)

26 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
secretedsecretedconnectomeDB2020NoNoYesNoNo
secretedsecretedMatrisomeNoNoYesNoNo
secretedsecretedCellinkerNoNoYesNoNo
secretedsecretedOmniPathNoNoYesNoNo
ligandligandtalklrYesNoYesNoNo
ligandligandCellinkerYesNoYesNoNo
ligandligandconnectomeDB2020YesNoYesNoNo
ligandligandMatrisomeYesNoYesNoNo
ligandligandiTALKYesNoYesNoNo
ligandligandICELLNETYesNoYesNoNo
Page 2 of 3PreviousNext

Regulatory Interaction Network (3)

3 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
S10A9P06702TLR4O00206YesYesNoFantom5_LRdbCellTalkDBiTALKtalklrICELLNETReactome_LRdbSIGNORconnectomeDB2020LRdbRamilowski2015ICELLNET:17767165talklr:17767165connectomeDB2020:17767165CellTalkDB:17767165SIGNOR:28137827Ramilowski2015:17767165LRdb:17767165
S10A9P06702RAGEQ15109YesYesNoInnateDBCellinkerCellTalkDBSIGNORCellinker:28504650InnateDB:23667563CellTalkDB:28504650SIGNOR:28137827
MK14Q16539S10A9P06702YesNoNophosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapperPhosphoSite:22230807PhosphoSite:2478889PhosphoSite:17429438PhosphoSite:15905572

Protein Complex Composition (5)

5 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
Calprotectin complexS100A8S100A9P05109P067026:6CORUMSIGNORComplexPortalPDBSIGNOR:SIGNOR-C293PDB:5w1fPDB:8sjbintact:EBI-10098681PDB:1xk4CORUM:6826PDB:4ggfPDB:8sjcPDB:4xjkintact:EBI-10098135PDB:7quvPDB:1XK4PDB:4GGFPDB:6ds21705000417553524255974471475529229890074
S100A9 complexS100A9P067022ComplexPortalPDBPDB:1irjintact:EBI-10099500PDB:5i8nPDB:1IRJPDB:7ui515642721224891321475529223123827
iNOS-S100A8/A9 complexNOS2S100A8S100A9P05109P06702P352281:1:1CORUMComplexPortalCORUM:6827intact:EBI-101059151475529225417112
S100A7S100A8S100A9P05109P06702P311510:0:0hu.MAP2
S100A8S100A9SUSD3P05109P06702Q96L080:0:0hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyPolymer PrecipitationWestern blotting|Mass spectrometry|FACSMass spectrometryR Sequencing1029045505356114623816890639505756216304622789410429045505383215353955813434980157
Sequence, Structure & Domains12

Sequences

Length
114
Mass
13,242
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

3D Structural Models

Turn
45..49; 95..97; 108..110
Helix
7..23; 34..44; 50..53; 56..66; 76..94
Beta Strand
25..28; 71..74
3D Structure
NMR spectroscopy (2); X-ray crystallography (9)

Domain & Motif Annotations

Compositional Bias
93..102; Basic and acidic residues
Domain (FT)
12..47; EF-hand 1; 54..89; EF-hand 2
Region
93..114; Disordered
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance9
Disease Involvement
Cancer-related genes
Biomarker
Phase 2; Phase 3
Drug Targets (2)
Clinical trial targetLiterature-reported target
Interaction Protein (4)
ENSG00000137486ENSG00000141480ENSG00000143546ENSG00000158828
Interaction Count
4
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications18
PMIDTitleAbstract
23585443Proteome profiling of exosomes derived from human primary and metastatic colorectal cancer cells reveal differential expression of key metastatic factors and signal transduction components.A key finding of this study was the detection and colocalization of protein complexes EPCAM-CLDN7 and TNIK-RAP2A in colorectal cancer cell exosomes. A major finding was the selective enrichment of metastatic factors (MET, S100A8, S100A9, TNC), signal transduction molecules (EFNB2, JAG1, SRC, TNIK), and lipid raft and lipid raft-associated components (CAV1, FLOT1, FLOT2, PROM1) in exosomes derived from metastatic SW620 cells. Exosomes purified using OptiPrep™ density gradient fractionation were 40-100 nm in diameter, were of a buoyant density ~1.09 g/mL, and displayed stereotypic exosomal markers TSG101, Alix, and CD63.
24295599Exosomes from myeloid-derived suppressor cells carry biologically active proteins.The pro-inflammatory proteins S100A8 and S100A9, previously shown to be secreted by MDSC and to be chemotactic for MDSC, are abundant in MDSC-derived exosomes.
27353274Histopathological assessment of calcification and inflammation of calcific aortic valves from patients with and without diabetes mellitus.Furthermore, in diabetic patients we found significantly increased expression of annexin II (p=0.04) and annexin V (p=0.04), both of which are thought to play a role in microcalcification formation via apoptosis or extracellular vesicle release.
27748581Evaluation of Spectral Counting for Relative Quantitation of Proteoforms in Top-Down Proteomics.Following the evaluation and comparison of these label-free top-down quantitation strategies using spiked proteins, spectral counting, along with normalized chromatographic peak areas and intensities, were used to analyze the complex protein cargo of exosomes shed by myeloid-derived suppressor cells collected under high and low conditions of inflammation, revealing statistically significant differences in abundance for several proteoforms, including the active pro-inflammatory proteins S100A8 and S100A9.
30990781Comparison of six commercial serum exosome isolation methods suitable for clinical laboratories. Effect in cytokine analysis.Albumin was present in all exosome extracts analyzed and ApoB in all except those extracted with Exo-Flow and ME. Exosome markers CD63, CD9 and TSG101 were determined by Western blot.
31559140Granulocytic Myeloid-Derived Suppressor Cells Promote the Stemness of Colorectal Cancer Cells through Exosomal S100A9.Hypoxia induces G-MDSCs to secrete more exosomes in a hypoxia-inducible factor 1α (HIF-1α)-dependent manner, and respiratory hyperoxia can reduce CRC cells stemness through the inhibition of GM-Exo production. It is found that S100A9, is highly expressed in G-MDSC-derived exosomes, and its blockade suppresses CRC cell stemness and the susceptibility of mice to AOM/DSS-induced colitis-associated colon cancer.
32051051Electron Microscopy-Based Comparison and Investigation of the Morphology of Exosomes Derived from Hepatocellular Carcinoma Cells Isolated at Different Centrifugal Speeds.Transforming growth factor signaling bioactive substances (TGF-β1, S100A8, and S100A9) can be found in exosomes by performing Western blotting, showing that the internal content is associated with metastasis of HCC.
32460581S100A9-RAGE Axis Accelerates Formation of Macrophage-Mediated Extracellular Vesicle Microcalcification in Diabetes Mellitus.Our goal was to identify that increased S100A9 promotes the release of calcification-prone extracellular vesicles from human macrophages in diabetes mellitus. Recombinant S100A9 induced the expression of proinflammatory and osteogenic factors, as well as the number of extracellular vesicles with high calcific potential (alkaline phosphatase activity, Under hyperglycemic conditions, macrophages release calcific extracellular vesicles through mechanisms involving the S100A9-RAGE axis, thus contributing to the formation of microcalcification within atherosclerotic plaques.
33275138Elongated neutrophil-derived structures are blood-borne microparticles formed by rolling neutrophils during sepsis.Unlike neutrophil-derived extracellular vesicles, most ENDS are negative for the tetraspanins CD9, CD63, and CD81.
33338939Molecular cargo in myeloid-derived suppressor cells and their exosomes.Bioassays showed that exosomes induce MDSC chemotaxis dependent on S100A8 and S100A9 in their cargo. Surface selective chemistry identified glycoproteins on MDSC and exosome surfaces, including CD47 and thrombospondin 1, which both facilitate exosome-catalyzed chemotaxis.
Page 1 of 2Next