Protein detail
S10A9
Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein symbol S10A9 | UniProt ID | EVMP score 0.72 |
Frequency 19 | Transmembrane count | Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins |
Basic Information
Protein Names
Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein Class
Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
Protein Function
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
60B8AGCAGBCFAGCGLBLIAGMAC387MIFMRP-14MRP14NIFP14S100-A9
Gene Description
S100 calcium binding protein A9
Chromosome
1
Position
153357854-153361023
Frequency
19
EVMP Score
0.72
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Predicted intracellular proteins
Cellular Component
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005886 plasma membrane
- GO:0034774 secretory granule lumen
- GO:0062023 collagen-containing extracellular matrix
- GO:0070062 extracellular exosome
- GO:1990660 calprotectin complex
- GO:1990662 S100A9 complex
Molecular Function
Biological Process
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-6803157 antimicrobial peptides
- R-hsa-2173782 binding and uptake of ligands by scavenger receptors
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-5260271 diseases of immune system
- R-hsa-168249 innate immune system
- R-hsa-5603041 irak4 deficiency tlr2 4
- R-hsa-6799990 metal sequestration by antimicrobial proteins
- R-hsa-6798695 neutrophil degranulation
- R-hsa-5686938 regulation of tlr by endogenous ligand
- R-hsa-5668599 rho gtpases activate nadph oxidases
- R-hsa-195258 rho gtpase effectors
- R-hsa-3000471 scavenging by class b receptors
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-168898 toll like receptor cascades
- R-hsa-168179 toll like receptor tlr1 tlr2 cascade
- R-hsa-5653656 vesicle mediated transport
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
1 record.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| S100A9 | MAPK14 | Q16539 | T | 113 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling
26 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ligand | ligand | CellTalkDB | Yes | No | Yes | No | No |
| ligand | ligand | Ramilowski2015 | Yes | No | Yes | No | No |
| ligand | ligand | LRdb | Yes | No | Yes | No | No |
| innate_immune | ligand | ICELLNET | Yes | No | Yes | No | No |
| innate_immune_tlr | ligand | ICELLNET | Yes | No | Yes | No | No |
| ligand | ligand | OmniPath | Yes | No | Yes | No | No |
Page 3 of 3Previous
Regulatory Interaction Network
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| S10A9 | P06702 | TLR4 | O00206 | Yes | Yes | No | Fantom5_LRdbCellTalkDBiTALKtalklrICELLNETReactome_LRdbSIGNORconnectomeDB2020LRdbRamilowski2015 | ICELLNET:17767165talklr:17767165connectomeDB2020:17767165CellTalkDB:17767165SIGNOR:28137827Ramilowski2015:17767165LRdb:17767165 |
| S10A9 | P06702 | RAGE | Q15109 | Yes | Yes | No | InnateDBCellinkerCellTalkDBSIGNOR | Cellinker:28504650InnateDB:23667563CellTalkDB:28504650SIGNOR:28137827 |
| MK14 | Q16539 | S10A9 | P06702 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:22230807PhosphoSite:2478889PhosphoSite:17429438PhosphoSite:15905572 |
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Calprotectin complex | S100A8S100A9 | P05109P06702 | 6:6 | CORUMSIGNORComplexPortalPDB | SIGNOR:SIGNOR-C293PDB:5w1fPDB:8sjbintact:EBI-10098681PDB:1xk4CORUM:6826PDB:4ggfPDB:8sjcPDB:4xjkintact:EBI-10098135PDB:7quvPDB:1XK4PDB:4GGFPDB:6ds2 | 1705000417553524255974471475529229890074 |
| S100A9 complex | S100A9 | P06702 | 2 | ComplexPortalPDB | PDB:1irjintact:EBI-10099500PDB:5i8nPDB:1IRJPDB:7ui5 | 15642721224891321475529223123827 |
| iNOS-S100A8/A9 complex | NOS2S100A8S100A9 | P05109P06702P35228 | 1:1:1 | CORUMComplexPortal | CORUM:6827intact:EBI-10105915 | 1475529225417112 |
| S100A7S100A8S100A9 | P05109P06702P31151 | 0:0:0 | hu.MAP2 | |||
| S100A8S100A9SUSD3 | P05109P06702Q96L08 | 0:0:0 | hu.MAP2 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyPolymer Precipitation | Western blotting|Mass spectrometry|FACSMass spectrometryR Sequencing | 10 | 29045505356114623816890639505756216304622789410429045505383215353955813434980157 |
Sequence, Structure & Domains
Sequences
Length
114
Mass
13,242
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
3D Structural Models
Turn
45..49; 95..97; 108..110
Helix
7..23; 34..44; 50..53; 56..66; 76..94
Beta Strand
25..28; 71..74
3D Structure
NMR spectroscopy (2); X-ray crystallography (9)
Domain & Motif Annotations
Compositional Bias
93..102; Basic and acidic residues
Domain (FT)
12..47; EF-hand 1; 54..89; EF-hand 2
Region
93..114; Disordered
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 2; Phase 3
Drug Targets
Clinical trial targetLiterature-reported target
Interaction Protein
ENSG00000137486ENSG00000141480ENSG00000143546ENSG00000158828
Interaction Count
4
Interaction Dataset
intact_biogridbiogrid_bioplex