Protein detail

S10A9

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Entry name S10A9	UniProt ID P06702	EVMP confidence score 0.72
Supporting publications (n) 19	Transmembrane count	Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Protein Class (4)

Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Predicted intracellular proteins

Ensembl

ENSG00000163220

Entrez Gene Symbol

S100A9

Gene Synonym (12)

60B8AGCAGBCFAGCGLBLIAGMAC387MIFMRP-14MRP14NIFP14S100-A9

Gene Description

S100 calcium binding protein A9

Chromosome

Position

153357854-153361023

Supporting publications (n)

EVMP confidence score

0.72

Fluorescence & Localization4

Tissue SpecificintestineCell SpecificColonocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes

Function & Pathway7

Protein Function (3)

Cancer-related genes:Candidate cancer biomarkers
Predicted secreted proteins
Predicted intracellular proteins

Cellular Component (12)

Page 1 of 2

Molecular Function (9)

Biological Process (3)

KEGG (2)

Reactome (18)

Page 1 of 2

Mediation Categories (4)

Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence36

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
S100A9	MAPK14	Q16539	T	113	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (26)

26 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
secreted	secreted	connectomeDB2020	No	No	Yes	No	No
secreted	secreted	Matrisome	No	No	Yes	No	No
secreted	secreted	Cellinker	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No
ligand	ligand	talklr	Yes	No	Yes	No	No
ligand	ligand	Cellinker	Yes	No	Yes	No	No
ligand	ligand	connectomeDB2020	Yes	No	Yes	No	No
ligand	ligand	Matrisome	Yes	No	Yes	No	No
ligand	ligand	iTALK	Yes	No	Yes	No	No
ligand	ligand	ICELLNET	Yes	No	Yes	No	No

Page 2 of 3Previous Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
S10A9	P06702	TLR4	O00206	Yes	Yes	No	Fantom5_LRdbCellTalkDBiTALKtalklrICELLNETReactome_LRdbSIGNORconnectomeDB2020LRdbRamilowski2015	ICELLNET:17767165 talklr:17767165 connectomeDB2020:17767165 CellTalkDB:17767165 SIGNOR:28137827 Ramilowski2015:17767165 LRdb:17767165
S10A9	P06702	RAGE	Q15109	Yes	Yes	No	InnateDBCellinkerCellTalkDBSIGNOR	Cellinker:28504650 InnateDB:23667563 CellTalkDB:28504650 SIGNOR:28137827
MK14	Q16539	S10A9	P06702	Yes	No	No	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper	PhosphoSite:22230807 PhosphoSite:2478889 PhosphoSite:17429438 PhosphoSite:15905572

Protein Complex Composition (5)

5 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
Calprotectin complex	S100A8 S100A9	P05109 P06702	6:6	CORUMSIGNORComplexPortalPDB	SIGNOR:SIGNOR-C293PDB:5w1fPDB:8sjbintact:EBI-10098681PDB:1xk4CORUM:6826PDB:4ggfPDB:8sjcPDB:4xjkintact:EBI-10098135PDB:7quvPDB:1XK4PDB:4GGFPDB:6ds2	17050004 17553524 25597447 14755292 29890074
S100A9 complex	S100A9	P06702	2	ComplexPortalPDB	PDB:1irjintact:EBI-10099500PDB:5i8nPDB:1IRJPDB:7ui5	15642721 22489132 14755292 23123827
iNOS-S100A8/A9 complex	NOS2 S100A8 S100A9	P05109 P06702 P35228	1:1:1	CORUMComplexPortal	CORUM:6827intact:EBI-10105915	14755292 25417112
	S100A7 S100A8 S100A9	P05109 P06702 P31151	0:0:0	hu.MAP2
	S100A8 S100A9 SUSD3	P05109 P06702 Q96L08	0:0:0	hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyPolymer Precipitation	Western blotting\|Mass spectrometry\|FACSMass spectrometryR Sequencing	10	29045505 35611462 38168906 39505756 21630462 27894104 29045505 38321535 39558134 34980157

Sequence, Structure & Domains12

Sequences

Length

114

Mass

13,242

Sequence

MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

3D Structural Models

Turn

45..49; 95..97; 108..110

Helix

7..23; 34..44; 50..53; 56..66; 76..94

Beta Strand

25..28; 71..74

3D Structure

NMR spectroscopy (2); X-ray crystallography (9)

Domain & Motif Annotations

Compositional Bias

93..102; Basic and acidic residues

Domain (FT)

12..47; EF-hand 1; 54..89; EF-hand 2

Region

93..114; Disordered

Protein Families

S-100 family

Sequence Similarities

Belongs to the S-100 family.

Clinical Relevance9

Disease Involvement

Cancer-related genes

Related Diseases (2)

Lupus erythematosus Prostate cancer

Biomarker

Phase 2; Phase 3

Drug Targets (2)

Clinical trial targetLiterature-reported target

Drugs (2)

PAQUINIMOD TASQUINIMOD

Antibody (3)

HPA004193 CAB009441 CAB080262

Interaction Protein (4)

ENSG00000137486ENSG00000141480ENSG00000143546ENSG00000158828

Interaction Count

Interaction Dataset (2)

intact_biogridbiogrid_bioplex

Supporting Publications18

PMID	Title	Abstract
33607398	Characterization of the perioperative changes of exosomal immune-related cytokines induced by prostatectomy in early-stage prostate cancer patients.	Cytokine levels of CCL2, CXCL5 decreased in patients' postsurgical exosomes, while TGF-ß further increased. Also, presurgical TGF-ß decreased both in serum and exosomes as Gleason score rises. Cytokines related with MDSC cell recruitment and activation CCL2, CXCL2, CXCL5, CXCL8, CXCL12, MIF, S100A9 and TGF-ß were measured in serum and serum-derived exosomes using immunometric assays. Exosomes were enriched specially in MIF, TGF-ß and CXCL2. On the contrary, S100A9 levels were lower in patientś presurgical exosomes but increased after radical prostatectomy. Patientś presurgical exosomes had increased CCL2, CXCL5 and TGF-ß levels than exosomes from healthy controls. Presurgical MIF levels in exosomes correlated negatively with serum PSA.
33859068	S100A9-containing serum exosomes of burn injury patients promote permeability of pulmonary microvascular endothelial cells.	Here we hypothesized that S100A9-containing serum exosomes of patients with burn injury contribute to pathogenesis of hyperpermeability of microvascular structure in lung by transferring signaling molecules into it and activating downstream signaling pathways, ultimately leading to disruption of the tight junctions (TJs) and endothelial barrier.
34305563	Bioinformatic Analysis of the Proteome in Exosomes Derived From Plasma: Exosomes Involved in Cholesterol Metabolism Process of Patients With Spinal Cord Injury in the Acute Phase.	The main components of cholesterol [ApoB-48 and ApoB-100 increased, ApoA-I, ApoA-II, ApoA-IV, ApoC, ApoE, and Apo(a) decreased] were changed in exosomes derived from plasma of patients.
34599510	Inflammatory capacity of exosomes released in the early stages of acute pancreatitis predicts the severity of the disease.	In particular, an increase in the amount of S100A8 and S100A9 carried by exosomes of severe pancreatitis suggests that the mechanism of action of exosomes is mediated by the effect of these proteins on NADPH oxidase.
35935235	Association Between Plasma Exosomes S100A9/C4BPA and Latent Tuberculosis Infection Treatment: Proteomic Analysis Based on a Randomized Controlled Study.	Totally, two sample sets for screening ( Our findings suggest that downregulated C4BPA and S100A9 in plasma exosomes might be associated with a host positive response to LTBI treatment.
36277145	S100A9‑containing serum exosomes obtained from patients with burn injuries promote myocardial cell pyroptosis through NLRP3.	When AC16 cells were treated with the serum exosomes obtained from patients with burn injuries, pyroptosis was significantly promoted and the expression levels of IL-1β and IL-18 were increased.
37051106	Renal tubular epithelial cells treated with calcium oxalate up-regulate S100A8 and S100A9 expression in M1-polarized macrophages via interleukin 6.	Calgranulins S100A8 and S100A9 are common in renal stones and they are up-regulated in both urinary exosomes and kidneys of stone patients.
37405532	Establishment and Evaluation of Exosomes-Related Gene Risk Model in Hepatocellular Carcinoma.	Exosomes have been shown to play an important role in HCC development and have significant potential in managing HCC patient prognosis, as they are detectable in patients' blood.

Page 2 of 2Previous