Protein detail

S10A9

Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)

Entry name
S10A9
UniProt ID
EVMP confidence score
0.72
Supporting publications (n)
19
Transmembrane count
Protein classification
Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information11
Protein Names
Protein S100-A9 (Calgranulin-B) (Calprotectin L1H subunit) (Leukocyte L1 complex heavy chain) (Migration inhibitory factor-related protein 14) (MRP-14) (p14) (S100 calcium-binding protein A9)
Protein Class (4)
Cancer-related genesPlasma proteinsPredicted intracellular proteinsPredicted secreted proteins
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Predicted intracellular proteins
Entrez Gene Symbol
Gene Synonym (12)
60B8AGCAGBCFAGCGLBLIAGMAC387MIFMRP-14MRP14NIFP14S100-A9
Gene Description
S100 calcium binding protein A9
Chromosome
1
Position
153357854-153361023
Supporting publications (n)
19
EVMP confidence score
0.72
Fluorescence & Localization4
Tissue SpecificintestineCell SpecificColonocytesBlood Cell SpecificneutrophilBlood Lineage Specificgranulocytes
Function & Pathway7
Protein Function (3)
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Predicted intracellular proteins
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence36

Enzyme-Mediated Modification (1)

1 record.

Substrate Gene SymbolEnzyme Gene SymbolEnzyme UniProt IDResidue TypeResidue OffsetModificationDatabaseReferences
S100A9MAPK14Q16539T113phosphorylationphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling (26)

26 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
ligandligandCellTalkDBYesNoYesNoNo
ligandligandRamilowski2015YesNoYesNoNo
ligandligandLRdbYesNoYesNoNo
innate_immuneligandICELLNETYesNoYesNoNo
innate_immune_tlrligandICELLNETYesNoYesNoNo
ligandligandOmniPathYesNoYesNoNo
Page 3 of 3Previous

Regulatory Interaction Network (3)

3 records.

Source Protein SymbolSource UniProt IDTarget Protein SymbolTarget UniProt IDIs DirectedIs StimulationIs InhibitionDatabaseReferences
S10A9P06702TLR4O00206YesYesNoFantom5_LRdbCellTalkDBiTALKtalklrICELLNETReactome_LRdbSIGNORconnectomeDB2020LRdbRamilowski2015ICELLNET:17767165talklr:17767165connectomeDB2020:17767165CellTalkDB:17767165SIGNOR:28137827Ramilowski2015:17767165LRdb:17767165
S10A9P06702RAGEQ15109YesYesNoInnateDBCellinkerCellTalkDBSIGNORCellinker:28504650InnateDB:23667563CellTalkDB:28504650SIGNOR:28137827
MK14Q16539S10A9P06702YesNoNophosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapperPhosphoSite:22230807PhosphoSite:2478889PhosphoSite:17429438PhosphoSite:15905572

Protein Complex Composition (5)

5 records.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
Calprotectin complexS100A8S100A9P05109P067026:6CORUMSIGNORComplexPortalPDBSIGNOR:SIGNOR-C293PDB:5w1fPDB:8sjbintact:EBI-10098681PDB:1xk4CORUM:6826PDB:4ggfPDB:8sjcPDB:4xjkintact:EBI-10098135PDB:7quvPDB:1XK4PDB:4GGFPDB:6ds21705000417553524255974471475529229890074
S100A9 complexS100A9P067022ComplexPortalPDBPDB:1irjintact:EBI-10099500PDB:5i8nPDB:1IRJPDB:7ui515642721224891321475529223123827
iNOS-S100A8/A9 complexNOS2S100A8S100A9P05109P06702P352281:1:1CORUMComplexPortalCORUM:6827intact:EBI-101059151475529225417112
S100A7S100A8S100A9P05109P06702P311510:0:0hu.MAP2
S100A8S100A9SUSD3P05109P06702Q96L080:0:0hu.MAP2

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion ChromatographyPolymer PrecipitationWestern blotting|Mass spectrometry|FACSMass spectrometryR Sequencing1029045505356114623816890639505756216304622789410429045505383215353955813434980157
Sequence, Structure & Domains12

Sequences

Length
114
Mass
13,242
Sequence
MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP

3D Structural Models

Turn
45..49; 95..97; 108..110
Helix
7..23; 34..44; 50..53; 56..66; 76..94
Beta Strand
25..28; 71..74
3D Structure
NMR spectroscopy (2); X-ray crystallography (9)

Domain & Motif Annotations

Compositional Bias
93..102; Basic and acidic residues
Domain (FT)
12..47; EF-hand 1; 54..89; EF-hand 2
Region
93..114; Disordered
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance9
Disease Involvement
Cancer-related genes
Biomarker
Phase 2; Phase 3
Drug Targets (2)
Clinical trial targetLiterature-reported target
Interaction Protein (4)
ENSG00000137486ENSG00000141480ENSG00000143546ENSG00000158828
Interaction Count
4
Interaction Dataset (2)
intact_biogridbiogrid_bioplex
Supporting Publications18
PMIDTitleAbstract
33607398Characterization of the perioperative changes of exosomal immune-related cytokines induced by prostatectomy in early-stage prostate cancer patients.Cytokine levels of CCL2, CXCL5 decreased in patients' postsurgical exosomes, while TGF-ß further increased. Also, presurgical TGF-ß decreased both in serum and exosomes as Gleason score rises. Cytokines related with MDSC cell recruitment and activation CCL2, CXCL2, CXCL5, CXCL8, CXCL12, MIF, S100A9 and TGF-ß were measured in serum and serum-derived exosomes using immunometric assays. Exosomes were enriched specially in MIF, TGF-ß and CXCL2. On the contrary, S100A9 levels were lower in patientś presurgical exosomes but increased after radical prostatectomy. Patientś presurgical exosomes had increased CCL2, CXCL5 and TGF-ß levels than exosomes from healthy controls. Presurgical MIF levels in exosomes correlated negatively with serum PSA.
33859068S100A9-containing serum exosomes of burn injury patients promote permeability of pulmonary microvascular endothelial cells.Here we hypothesized that S100A9-containing serum exosomes of patients with burn injury contribute to pathogenesis of hyperpermeability of microvascular structure in lung by transferring signaling molecules into it and activating downstream signaling pathways, ultimately leading to disruption of the tight junctions (TJs) and endothelial barrier.
34305563Bioinformatic Analysis of the Proteome in Exosomes Derived From Plasma: Exosomes Involved in Cholesterol Metabolism Process of Patients With Spinal Cord Injury in the Acute Phase.The main components of cholesterol [ApoB-48 and ApoB-100 increased, ApoA-I, ApoA-II, ApoA-IV, ApoC, ApoE, and Apo(a) decreased] were changed in exosomes derived from plasma of patients.
34599510Inflammatory capacity of exosomes released in the early stages of acute pancreatitis predicts the severity of the disease.In particular, an increase in the amount of S100A8 and S100A9 carried by exosomes of severe pancreatitis suggests that the mechanism of action of exosomes is mediated by the effect of these proteins on NADPH oxidase.
35935235Association Between Plasma Exosomes S100A9/C4BPA and Latent Tuberculosis Infection Treatment: Proteomic Analysis Based on a Randomized Controlled Study.Totally, two sample sets for screening ( Our findings suggest that downregulated C4BPA and S100A9 in plasma exosomes might be associated with a host positive response to LTBI treatment.
36277145S100A9‑containing serum exosomes obtained from patients with burn injuries promote myocardial cell pyroptosis through NLRP3.When AC16 cells were treated with the serum exosomes obtained from patients with burn injuries, pyroptosis was significantly promoted and the expression levels of IL-1β and IL-18 were increased.
37051106Renal tubular epithelial cells treated with calcium oxalate up-regulate S100A8 and S100A9 expression in M1-polarized macrophages via interleukin 6.Calgranulins S100A8 and S100A9 are common in renal stones and they are up-regulated in both urinary exosomes and kidneys of stone patients.
37405532Establishment and Evaluation of Exosomes-Related Gene Risk Model in Hepatocellular Carcinoma.Exosomes have been shown to play an important role in HCC development and have significant potential in managing HCC patient prognosis, as they are detectable in patients' blood.
Page 2 of 2Previous