Protein detail
CO8A
Complement component C8 alpha chain (Complement component 8 subunit alpha)
Entry name CO8A | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 4 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Complement component C8 alpha chain (Complement component 8 subunit alpha)
Protein Function (5)
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Transmembrane
248..256; Beta stranded; 259..266; Beta stranded; 377..384; Beta stranded; 390..395; Beta stranded
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificEpicardial cells
Function & Pathway
Protein Function (5)
- Potential drug targets
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Transporter channels and pores
- Predicted secreted proteins
- Disease related genes
Cellular Component (7)
Molecular Function (3)
Biological Process (3)
KEGG (6)
Reactome (3)
Canonical Pathways (3)
- M138 Pid thrombin par4 pathway
- M155 Pid s1p meta pathway
- M268 Pid s1p s1p2 pathway
Mediation Categories
Immune mediation
Relations & Evidence18
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | Yes | |||
| ecm | ecm | OmniPath | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes |
Page 1 of 2Next
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Membrane attack complex | C5C6C7C8AC8BC8GC9 | P01031P02748P07357P07358P07360P10643P13671 | 2:1:1:1:1:1:1 | SIGNORComplexPortalPDB | PDB:6dlwPDB:6h04PDB:5fmwintact:EBI-25827364PDB:7nycPDB:7nydPDB:6h03SIGNOR:SIGNOR-C313 | 2684183726489954147552923466717230552328 |
| CLNS1ADDX20GEMIN2GEMIN5NCBP1RIC8ASMN1SNRPA1SNRPD2SNRPESNRPFSNRPG | O14893P09661P54105P62304P62306P62308P62316Q09161Q16637Q8TEQ6Q9NPQ8Q9UHI6 | 1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC4778 | ||
| C8AC8BC8G | P07357P07358P07360 | 1:1:1 | PDB | PDB:3ojy | ||
| C8AC8G | P07357P07360 | 1:1 | PDB | PDB:2qosPDB:2rd7 | ||
| SLC8A2SLC8A3 | P57103Q9UPR5 | 0:0 | hu.MAPhu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
584
Mass
65,163
Sequence
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRHRSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQDCLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETVYNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKVKKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAHFKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKAKMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDIISRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKRQNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADGSWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC
3D Structural Models
Turn
52..54; 158..161; 183..186; 192..195; 450..452; 503..505
Helix
111..113; 149..152; 201..203; 233..243; 273..280; 312..319; 327..337; 359..365; 369..379; 398..402; 408..413; 428..436; 443..449; 464..470; 477..491; 496..498
Beta Strand
56..60; 63..65; 69..71; 78..83; 97..101; 103..105; 116..118; 121..123; 127..129; 140..143; 154..157; 162..168; 179..182; 189..191; 196..198; 204..207; 212..217; 226..232; 246..252; 260..266; 287..303; 305..308; 339..358; 416..421; 455..463; 508..511; 514..517; 520..523; 525..527; 530..532; 552..554; 556..559; 567..570; 578..582
3D Structure
Electron microscopy (7); X-ray crystallography (4)
Domain & Motif Annotations
Domain (FT)
38..91; TSP type-1 1; 94..132; LDL-receptor class A; 135..498; MACPF; 499..529; EGF-like; 539..583; TSP type-1 2
Region
562..584; Disordered
Protein Families
Complement C6/C7/C8/C9 family
Sequence Similarities
Belongs to the complement C6/C7/C8/C9 family.
Clinical Relevance
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 27086912 | Comparative proteomics of exosomes secreted by tumoral Jurkat T cells and normal human T cell blasts unravels a potential tumorigenic role for valosin-containing protein. | No related sentences available |