Protein detail
TACD2
Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)
Entry name TACD2 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 16 | Transmembrane count 1 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)
Protein Class (4)
Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- FDA approved drug targets:Biotech drugs
Transmembrane
275..297; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
EGP-1GA733-1M1S1TROP2
Gene Description
Tumor associated calcium signal transducer 2
Chromosome
1
Position
58575433-58577252
Supporting publications (n)
16
EVMP confidence score
0.72
Function & Pathway5
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- FDA approved drug targets:Biotech drugs
Cellular Component (7)
Molecular Function
Biological Process (3)
Mediation Categories (3)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation
Relations & Evidence31
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TACSTD2 | PRKCA | P17252 | S | 303 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | phosphoELM:7635574KEA:7635574 |
| TACSTD2 | PRKCA | P17252 | S | 322 | phosphorylation | PhosphoSite | |
| TACSTD2 | PRKCD | Q05655 | S | 322 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (23)
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Page 3 of 3Previous
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCD | Q05655 | TACD2 | P09758 | Yes | No | Yes | SIGNORPhosphoSite_ProtMapperProtMapper | SIGNOR:31177095 |
| TACD2 | P09758 | CLD7 | O95471 | Yes | Yes | No | HINTLit-BM-17SIGNOR | Lit-BM-17:20651236HINT:20651236SIGNOR:31177095HINT:33961781 |
| KPCA | P17252 | TACD2 | P09758 | Yes | No | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | KEA:7635574phosphoELM:7635574SIGNOR:31177095PhosphoSite:31177095PhosphoSite:25981199PhosphoSite:7635574 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30865381 |
Sequence, Structure & Domains10
Sequences
Length
323
Mass
35,709
Sequence
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
3D Structural Models
Turn
58..60; 121..123
Helix
49..51; 72..80; 169..182; 188..190; 209..211; 219..230; 299..317
Beta Strand
41..46; 54..57; 97..99; 112..114; 116..120; 124..129; 151..160; 191..197; 200..206; 237..239; 253..264
3D Structure
NMR spectroscopy (3); X-ray crystallography (3)
Domain & Motif Annotations
Domain (FT)
70..145; Thyroglobulin type-1
Protein Families
EPCAM family
Sequence Similarities
Belongs to the EPCAM family.
Clinical Relevance6
Disease Involvement (3)
AmyloidosisCorneal dystrophyFDA approved drug targets
Related Diseases (4)
Biomarker
Approved; Phase 3; Phase 1/2
Drug Targets
FDA approved drug targets
Drugs (2)
Supporting Publications16
| PMID | Title | Abstract |
|---|---|---|
| 23161513 | Proteomic analysis of exosomes from mutant KRAS colon cancer cells identifies intercellular transfer of mutant KRAS. | Exosomes from mutant KRAS cells contain many tumor-promoting proteins, including KRAS, EGFR, SRC family kinases, and integrins. |
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 29045505 | Surfaceome profiling enables isolation of cancer-specific exosomal cargo in liquid biopsies from pancreatic cancer patients. | Proteomic analysis of the exosome 'surfaceome' revealed multiple PDAC-specific biomarker candidates: CLDN4, EPCAM, CD151, LGALS3BP, HIST2H2BE, and HIST2H2BF. Droplet digital PCR was used on 74 patients (136 total exosome samples) to determine baseline KRAS mutation call rates while patients were on therapy. KRAS mutations in total exosomes were detected in 44.1% of patients undergoing active therapy compared with 73.0% following exosome capture using the selected biomarkers. |
| 30379855 | Harmonization of exosome isolation from culture supernatants for optimized proteomics analysis. | No abstract available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No abstract available |
| 34186243 | A Reductionist Approach Using Primary and Metastatic Cell-Derived Extracellular Vesicles Reveals Hub Proteins Associated with Oral Cancer Prognosis. | No abstract available |
| 34571828 | Proteomic Analysis of Circulating Extracellular Vesicles Identifies Potential Biomarkers for Lymph Node Metastasis in Oral Tongue Squamous Cell Carcinoma. | No abstract available |
Page 1 of 2Next