Protein detail
HLAC
HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C)
Protein symbol HLAC | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification |
Basic Information
Protein Names
HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C)
Protein Function
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Transmembrane
309..333; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Tissue Specificadrenal glandCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030667 secretory granule membrane
- GO:0030670 phagocytic vesicle membrane
- GO:0031901 early endosome membrane
- GO:0042612 MHC class I protein complex
- GO:0055038 recycling endosome membrane
- GO:0070062 extracellular exosome
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Molecular Function
Biological Process
KEGG
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05167 Kaposi sarcoma-associated herpesvirus infection
- KEGG:hsa05168 Herpes simplex virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05203 Viral carcinogenesis
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-909733 interferon alpha beta signaling
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-6798695 neutrophil degranulation
- R-hsa-9705671 sars cov 2 activates modulates innate and adaptive immune responses
- R-hsa-9705683 sars cov 2 host interactions
- R-hsa-9694516 sars cov 2 infection
- R-hsa-9679506 sars cov infections
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | Baccin2019 | No | No | No | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry|Western blottingMass spectrometry [LTQ-FT Ultra]Mass spectrometry | 19 | 27863537323413573294419339940641294367804074865839505756372050982898658526378940278941043064661633919183395379563832153529148239351949653208974339940641 |
Sequence, Structure & Domains
Sequences
Length
366
Mass
40,649
Sequence
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P10321-1; Sequence=Displayed; Name=2; IsoId=P10321-2; Sequence=VSP_060393, VSP_060394
Alternative Sequence
153..157; DLRSW -> HLRSC (in isoform 2); 297..338; SWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSS -> RW (in isoform 2)
3D Structural Models
Turn
39..41
Helix
74..77; 81..109; 162..174; 176..185; 187..198; 200..203; 249..251; 278..280
Beta Strand
27..36; 45..52; 55..61; 64..66; 70..73; 113..115; 118..127; 131..142; 145..150; 157..159; 210..217; 219..235; 238..243; 252..254; 261..263; 265..274; 281..286; 290..292; 294..297
3D Structure
X-ray crystallography (13)
Domain & Motif Annotations
Domain (CC)
The alpha-1 domain is a structural part of the peptide-binding cleft.; DOMAIN: The alpha-2 domain is a structural part of the peptide-binding cleft (PubMed:10850706, PubMed:24990997, PubMed:28649982). Mediates the interaction with TAP1-TAP2 complex.; DOMAIN: The alpha-3 Ig-like domain mediates the interaction with CD8 coreceptor.; DOMAIN: The VL9 peptide/epitope (VMAPRT[V/L][L/V/I/F]L) derived from the signal sequence is loaded onto HLA-E and enables HLA-E expression at the plasma membrane. Distinct VL9 peptides presented by HLA-E variably affect its recognition by KLRD1-KLRC1 or KLRD1-KLRC2 receptors on NK cells, setting NK cell activation threshold. Common HLA-C allotypes contain functional VL9 peptides (VMAPRTLIL and VMAPRTLLL). VL9 peptides (VMAPRTALL and VMAPRQALL) derived from HLA-C*07, C*17 and C*18 allotypes display low affinity for HLA-E and fail to drive NK cell activation.
Domain (FT)
209..297; Ig-like C1-type
Region
3..11; VL9 epitope; 25..114; Alpha-1; 115..206; Alpha-2; 207..298; Alpha-3; 299..308; Connecting peptide
Clinical Relevance
Drugs
Interaction Protein
ENSG00000044574ENSG00000106460ENSG00000125498ENSG00000166523ENSG00000169071ENSG00000169213ENSG00000178999ENSG00000206503ENSG00000234745ENSG00000243772
Interaction Count
10
Interaction Dataset
biogrid_bioplexintact_biogrid