Protein detail
HLAC
HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C)
Entry name HLAC | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
HLA class I histocompatibility antigen, C alpha chain (HLA-C) (HLA-Cw) (Human leukocyte antigen C)
Protein Function (3)
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Transmembrane
309..333; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization3
Tissue Specificadrenal glandCell SpecificAdrenal cortex cellsSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway7
Protein Function (3)
- Disease related genes
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Predicted intracellular proteins
Cellular Component (16)
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030667 secretory granule membrane
Page 1 of 2
Molecular Function (4)
Biological Process (3)
KEGG (19)
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
Page 1 of 2
Reactome (19)
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-2172127 dap12 interactions
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
Page 1 of 2
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence50
Ligand-Receptor Signaling (48)
48 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| ligand | ligand | talklr | Yes | No | No | Yes | No |
| ligand | ligand | iTALK | Yes | No | No | Yes | No |
| ligand | ligand | GO_Intercell | Yes | No | No | Yes | No |
| ligand | ligand | ICELLNET | Yes | No | No | Yes | No |
| ligand | ligand | CellTalkDB | Yes | No | No | Yes | No |
| ligand | ligand | Ramilowski2015 | Yes | No | No | Yes | No |
| ligand | ligand | LRdb | Yes | No | No | Yes | No |
| ligand | ligand | Almen2009 | Yes | No | No | Yes | No |
| hla_recognition | ligand | ICELLNET | Yes | No | No | Yes | No |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture | Mass spectrometry|Western blottingMass spectrometry [LTQ-FT Ultra]Mass spectrometry | 19 | 27863537323413573294419339940641294367804074865839505756372050982898658526378940278941043064661633919183395379563832153529148239351949653208974339940641 |
Sequence, Structure & Domains12
Sequences
Length
366
Mass
40,649
Sequence
MRVMAPRALLLLLSGGLALTETWACSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSSGGKGGSCSQAACSNSAQGSDESLITCKA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P10321-1; Sequence=Displayed; Name=2; IsoId=P10321-2; Sequence=VSP_060393, VSP_060394
Alternative Sequence
153..157; DLRSW -> HLRSC (in isoform 2); 297..338; SWEPSSQPTIPIMGIVAGLAVLVVLAVLGAVVTAMMCRRKSS -> RW (in isoform 2)
3D Structural Models
Turn
39..41
Helix
74..77; 81..109; 162..174; 176..185; 187..198; 200..203; 249..251; 278..280
Beta Strand
27..36; 45..52; 55..61; 64..66; 70..73; 113..115; 118..127; 131..142; 145..150; 157..159; 210..217; 219..235; 238..243; 252..254; 261..263; 265..274; 281..286; 290..292; 294..297
3D Structure
X-ray crystallography (13)
Domain & Motif Annotations
Domain (CC)
The alpha-1 domain is a structural part of the peptide-binding cleft.; DOMAIN: The alpha-2 domain is a structural part of the peptide-binding cleft (PubMed:10850706, PubMed:24990997, PubMed:28649982). Mediates the interaction with TAP1-TAP2 complex.; DOMAIN: The alpha-3 Ig-like domain mediates the interaction with CD8 coreceptor.; DOMAIN: The VL9 peptide/epitope (VMAPRT[V/L][L/V/I/F]L) derived from the signal sequence is loaded onto HLA-E and enables HLA-E expression at the plasma membrane. Distinct VL9 peptides presented by HLA-E variably affect its recognition by KLRD1-KLRC1 or KLRD1-KLRC2 receptors on NK cells, setting NK cell activation threshold. Common HLA-C allotypes contain functional VL9 peptides (VMAPRTLIL and VMAPRTLLL). VL9 peptides (VMAPRTALL and VMAPRQALL) derived from HLA-C*07, C*17 and C*18 allotypes display low affinity for HLA-E and fail to drive NK cell activation.
Domain (FT)
209..297; Ig-like C1-type
Region
3..11; VL9 epitope; 25..114; Alpha-1; 115..206; Alpha-2; 207..298; Alpha-3; 299..308; Connecting peptide
Clinical Relevance4
Drugs (19)
Interaction Protein (10)
ENSG00000044574ENSG00000106460ENSG00000125498ENSG00000166523ENSG00000169071ENSG00000169213ENSG00000178999ENSG00000206503ENSG00000234745ENSG00000243772
Interaction Count
10
Interaction Dataset (2)
biogrid_bioplexintact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No abstract available |