Protein detail
DRB4
HLA class II histocompatibility antigen, DR beta 4 chain (MHC class II antigen DRB4)
Entry name DRB4 | UniProt ID | EVMP score 0.47 |
Frequency 14 | Transmembrane count 1 | Protein classification |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
HLA class II histocompatibility antigen, DR beta 4 chain (MHC class II antigen DRB4)
Transmembrane
228..250; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Frequency
14
EVMP Score
0.47
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdrenal medulla cells
Function & Pathway
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
- GO:0042613 MHC class II protein complex
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Biological Process
KEGG
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05150 Staphylococcus aureus infection
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05164 Influenza A
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05168 Herpes simplex virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05310 Asthma
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05321 Inflammatory bowel disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-202403 tcr signaling
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HLA-DRB4 | MARCHF1 | Q8TCQ1 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
| HLA-DRB4 | MARCHF8 | Q5T0T0 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
Ligand-Receptor Signaling
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | No | No | Yes | No |
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
Page 1 of 3Next
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARH8 | Q5T0T0 | DRB4 | P13762 | Yes | No | Yes | SIGNOR | SIGNOR:19117940 |
| MARH1 | Q8TCQ1 | DRB4 | P13762 | Yes | No | Yes | SIGNOR | SIGNOR:19117940 |
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DOAHLA-DRB4 | P06340P13762 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DRB4 | P13762P28067 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DRB4 | CHEBI:166824CHEBI:53000P06340P13762 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DRB4 | CHEBI:166824CHEBI:53000P13762P28067 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 |
Sequence, Structure & Domains
Sequences
Length
266
Mass
29,941
Sequence
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
3D Structural Models
Domain & Motif Annotations
Domain (FT)
126..216; Ig-like C1-type
Region
30..124; Beta-1; 125..227; Beta-2
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.