Protein detail
DRB4
HLA class II histocompatibility antigen, DR beta 4 chain (MHC class II antigen DRB4)
Entry name DRB4 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 14 | Transmembrane count 1 | Protein classification |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
HLA class II histocompatibility antigen, DR beta 4 chain (MHC class II antigen DRB4)
Transmembrane
228..250; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
14
EVMP confidence score
0.72
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdrenal medulla cells
Function & Pathway
Cellular Component (11)
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
- GO:0042613 MHC class II protein complex
Page 1 of 2
Molecular Function (2)
Biological Process (3)
KEGG (24)
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
Page 1 of 3
Reactome (11)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
Page 1 of 2
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence34
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HLA-DRB4 | MARCHF1 | Q8TCQ1 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
| HLA-DRB4 | MARCHF8 | Q5T0T0 | K | 254 | polyubiquitination | SIGNOR | SIGNOR:19117940 |
Ligand-Receptor Signaling (25)
25 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_surface_ligand | cell_surface_ligand | CellChatDB | Yes | Yes | |||
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes |
Page 1 of 3Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARH8 | Q5T0T0 | DRB4 | P13762 | Yes | Yes | SIGNOR | SIGNOR:19117940 | |
| MARH1 | Q8TCQ1 | DRB4 | P13762 | Yes | Yes | SIGNOR | SIGNOR:19117940 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DOAHLA-DRB4 | P06340P13762 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DRB4 | P13762P28067 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DRB4 | CHEBI:166824CHEBI:53000P06340P13762 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DRB4 | CHEBI:166824CHEBI:53000P13762P28067 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 |
Sequence, Structure & Domains
Sequences
Length
266
Mass
29,941
Sequence
MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Domain & Motif Annotations
Domain (FT)
126..216; Ig-like C1-type
Region
30..124; Beta-1; 125..227; Beta-2
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.
Clinical Relevance
Drugs (3)
Supporting Publications14
| PMID | Title | Related sentences |
|---|---|---|
| 39207047 | The trajectory of vesicular proteomic signatures from HBV-HCC by chitosan-magnetic bead-based separation and DIA-proteomic analysis. | No related sentences available |
| 40189497 | Small extracellular vesicle-based one-step high-throughput microfluidic platform for epithelial ovarian cancer diagnosis. | No related sentences available |
| 40465195 | Extracellular vesicle proteomics uncovers energy metabolism, complement system, and endoplasmic reticulum stress response dysregulation postexercise in males with myalgic encephalomyelitis/chronic fatigue syndrome. | No related sentences available |
| 41307968 | Extracellular Vesicles Define Discrete Nano-Based Niches Within the Human Haematopoietic System. | No related sentences available |
Page 2 of 2Previous