Protein detail

LYAM1

L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L)

Entry name LYAM1	UniProt ID P14151	EVMP confidence score 0.25
Supporting publications (n) 1	Transmembrane count 1	Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (6)

Cancer-related genesCandidate cardiovascular disease genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins

Protein Function (4)

Candidate cardiovascular disease genes
Cancer-related genes:Candidate cancer biomarkers
CD markers
Predicted intracellular proteins

Transmembrane

333..355; Helical

Transmembrane Count

Ensembl

ENSG00000188404

Entrez Gene Symbol

SELL

Gene Synonym (10)

CD62LhLHRcLAM-1LAM1Leu-8LNHRLSELLyam-1LYAM1PLNHR

Gene Description

Selectin L

Chromosome

Position

169690665-169711702

Supporting publications (n)

EVMP confidence score

0.25

Fluorescence & Localization5

Tissue Specificblood vesselCell SpecificMesothelial cellsBlood Cell SpecificbasophilSecretome LocationSecreted - unknown locationSecretome FunctionTransport

Function & Pathway7

Protein Function (4)

Candidate cardiovascular disease genes
Cancer-related genes:Candidate cancer biomarkers
CD markers
Predicted intracellular proteins

Cellular Component (4)

Molecular Function (8)

Biological Process (3)

KEGG

hsa04514 Cell adhesion molecule (CAM) interaction

Reactome (6)

Mediation Categories (4)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation

Relations & Evidence60

Ligand-Receptor Signaling (58)

58 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	HPMR	No	Yes	No	Yes	No
receptor	receptor	ICELLNET	No	Yes	No	Yes	No
receptor	receptor	CellChatDB	No	Yes	No	Yes	No
receptor	receptor	CellTalkDB	No	Yes	No	Yes	No
receptor	receptor	Surfaceome	No	Yes	No	Yes	No
receptor	receptor	Ramilowski2015	No	Yes	No	Yes	No
receptor	receptor	LRdb	No	Yes	No	Yes	No
receptor	receptor	Baccin2019	No	Yes	No	Yes	No
other_receptor_family	receptor	HPMR	No	Yes	No	Yes	No
selectin	receptor	HPMR	No	Yes	No	Yes	No

Page 1 of 6Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CALM1 SELL	P0DP23 P14151	1:1	PDB	PDB:2lgf

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Antibody array	2	32301581 38071653

Sequence, Structure & Domains12

Sequences

Length

372

Mass

42,187

Sequence

MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY

Alternative Products

Event=Alternative initiation; Named isoforms=2; Comment=The start of isoform 1 corresponds to the N-terminus of mammalian orthologs. The start codon for isoform 2 is in the same exon and reading frame as that for isoform 1, suggesting alternative initiation.; Name=1; IsoId=P14151-1; Sequence=Displayed; Name=2; IsoId=P14151-2; Sequence=VSP_042650

Alternative Sequence

1; M -> MGCRRTREGPSKAM (in isoform 2)

3D Structural Models

Turn

101..104; 109..111

Helix

50..60; 70..79; 122..124; 350..362

Beta Strand

40..43; 61..64; 90..94; 97..100; 128..131; 136..138; 142..145; 151..157; 167..174; 177..181; 187..191

3D Structure

NMR spectroscopy (1); X-ray crystallography (2)

Domain & Motif Annotations

Domain (FT)

55..155; C-type lectin; 156..192; EGF-like; 195..256; Sushi 1; 257..318; Sushi 2

Protein Families

Selectin/LECAM family

Sequence Similarities

Belongs to the selectin/LECAM family.

Clinical Relevance6

Disease Involvement

Cancer-related genes

Related Diseases (5)

Asthma Circulatory system disease Influenza Postoperative inflammation Psoriasis

Biomarker

Phase 3; Phase 2; Investigative; Terminated

Drug Targets

Clinical trial target

Drugs (4)

RIVIPANSEL ASELIZUMAB BIMOSIAMOSE NULL

Antibody (2)

CAB002144 HPA051972

Supporting Publications1

PMID	Title	Abstract
32384937	Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles.	No abstract available