Protein detail
LYAM1
L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L)
Entry name LYAM1 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
L-selectin (CD62 antigen-like family member L) (Leukocyte adhesion molecule 1) (LAM-1) (Leukocyte surface antigen Leu-8) (Leukocyte-endothelial cell adhesion molecule 1) (LECAM1) (Lymph node homing receptor) (TQ1) (gp90-MEL) (CD antigen CD62L)
Protein Class (6)
Cancer-related genesCandidate cardiovascular disease genesCD markersPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (4)
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Transmembrane
333..355; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (10)
CD62LhLHRcLAM-1LAM1Leu-8LNHRLSELLyam-1LYAM1PLNHR
Gene Description
Selectin L
Chromosome
1
Position
169690665-169711702
Supporting publications (n)
1
EVMP confidence score
0.25
Fluorescence & Localization5
Tissue Specificblood vesselCell SpecificMesothelial cellsBlood Cell SpecificbasophilSecretome LocationSecreted - unknown locationSecretome FunctionTransport
Function & Pathway7
Protein Function (4)
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- CD markers
- Predicted intracellular proteins
Cellular Component (4)
Molecular Function (8)
Biological Process (3)
Reactome (6)
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence60
Ligand-Receptor Signaling (58)
58 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| selectin | receptor | Surfaceome | No | Yes | No | Yes | No |
| cell_adhesion | receptor | ICELLNET | No | Yes | No | Yes | No |
| ecm_interaction | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| ecm | ecm | MatrixDB | Yes | No | No | Yes | No |
| ecm | ecm | OmniPath | Yes | No | No | Yes | No |
| extracellular | extracellular | HPMR | No | No | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
Protein Complex Composition (1)
Sequence, Structure & Domains12
Sequences
Length
372
Mass
42,187
Sequence
MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY
Alternative Products
Event=Alternative initiation; Named isoforms=2; Comment=The start of isoform 1 corresponds to the N-terminus of mammalian orthologs. The start codon for isoform 2 is in the same exon and reading frame as that for isoform 1, suggesting alternative initiation.; Name=1; IsoId=P14151-1; Sequence=Displayed; Name=2; IsoId=P14151-2; Sequence=VSP_042650
Alternative Sequence
1; M -> MGCRRTREGPSKAM (in isoform 2)
3D Structural Models
Turn
101..104; 109..111
Helix
50..60; 70..79; 122..124; 350..362
Beta Strand
40..43; 61..64; 90..94; 97..100; 128..131; 136..138; 142..145; 151..157; 167..174; 177..181; 187..191
3D Structure
NMR spectroscopy (1); X-ray crystallography (2)
Domain & Motif Annotations
Domain (FT)
55..155; C-type lectin; 156..192; EGF-like; 195..256; Sushi 1; 257..318; Sushi 2
Protein Families
Selectin/LECAM family
Sequence Similarities
Belongs to the selectin/LECAM family.
Clinical Relevance6
Disease Involvement
Cancer-related genes
Related Diseases (5)
Biomarker
Phase 3; Phase 2; Investigative; Terminated
Drug Targets
Clinical trial target
Drugs (4)
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |