Protein detail
AT1B2
Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2)
Entry name AT1B2 | UniProt ID | EVMP confidence score 0.25 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2)
Protein Class (3)
Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
40..67; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
AMOG
Gene Description
ATPase Na+/K+ transporting subunit beta 2
Chromosome
17
Position
7646627-7657770
Supporting publications (n)
4
EVMP confidence score
0.25
Fluorescence & Localization4
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificmidbrain-derived inhibitoryBlood Cell Specificnaive CD4 T-cell
Function & Pathway7
Protein Function
Predicted intracellular proteins
Cellular Component (14)
- GO:0001917 photoreceptor inner segment
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005890 sodium:potassium-exchanging ATPase complex
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0031253 cell projection membrane
- GO:0044298 cell body membrane
Page 1 of 2
Molecular Function (5)
Biological Process (3)
KEGG (19)
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04260 Cardiac muscle contraction
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04960 Aldosterone-regulated sodium reabsorption
Page 1 of 2
Reactome (13)
- R-hsa-210991 basigin interactions
- R-hsa-5576891 cardiac conduction
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-5578775 ion homeostasis
- R-hsa-936837 ion transport by p type atpases
- R-hsa-397014 muscle contraction
- R-hsa-9679191 potential therapeutics for sars
Page 1 of 2
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence37
Ligand-Receptor Signaling (31)
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transporter | transporter | Surfaceome | No | Yes | No | Yes | No |
| sodium_potassium_atpase | transporter | HGNC | No | Yes | No | Yes | No |
| transporter | transporter | HGNC | No | Yes | No | Yes | No |
| auxiliary_transport_unit | transporter | Almen2009 | No | Yes | No | Yes | No |
| atp1b | transporter | Surfaceome | No | Yes | No | Yes | No |
Page 1 of 4Next
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARL6IP1ATP1B2FAM241ARABAC1RTN2RTN4SH3PXD2ATFAMTMT1B | O75298P14415Q00059Q15041Q5TCZ1Q6UX53Q8N8J7Q9NQC3Q9UI14 | 0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| ATP1B2RTN4SH3PXD2ATFAM | P14415Q00059Q5TCZ1Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ARL6IP1ATP1B2RTN4SH3PXD2A | P14415Q15041Q5TCZ1Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ATP1B2RTN4SH3PXD2ATMT1B | P14415Q5TCZ1Q6UX53Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ATP1B2RABAC1RTN4SH3PXD2A | P14415Q5TCZ1Q9NQC3Q9UI14 | 0:0:0:0 | hu.MAP |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37704453 |
Sequence, Structure & Domains7
Sequences
Length
290
Mass
33,367
Sequence
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
Domain & Motif Annotations
Domain (CC)
The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
Region
193..290; immunoglobulin-like
Protein Families
X(+)/potassium ATPases subunit beta family
Sequence Similarities
Belongs to the X(+)/potassium ATPases subunit beta family.
Clinical Relevance2
Supporting Publications4
| PMID | Title | Abstract |
|---|---|---|
| 28242843 | Label-free Proteomic Analysis of Exosomes Derived from Inducible Hepatitis B Virus-Replicating HepAD38 Cell Line. | No abstract available |
| 37686366 | Identification of a Non-Invasive Urinary Exosomal Biomarker for Diabetic Nephropathy Using Data-Independent Acquisition Proteomics. | No abstract available |
| 37922300 | Proteomic profiling of urinary extracellular vesicles differentiates breast cancer patients from healthy women. | No abstract available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |