Protein detail
AT1B2
Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2)
Protein symbol AT1B2 | UniProt ID | EVMP score 0.25 |
Frequency 4 | Transmembrane count 1 | Protein classification Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
Sodium/potassium-transporting ATPase subunit beta-2 (Adhesion molecule in glia) (AMOG) (Sodium/potassium-dependent ATPase subunit beta-2)
Protein Class
Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
Predicted intracellular proteins
Transmembrane
40..67; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
AMOG
Gene Description
ATPase Na+/K+ transporting subunit beta 2
Chromosome
17
Position
7646627-7657770
Frequency
4
EVMP Score
0.25
Fluorescence & Localization
Tissue SpecificbrainCell SpecificBrain excitatory neuronsSingle-Nuclei Brain Specificmidbrain-derived inhibitoryBlood Cell Specificnaive CD4 T-cell
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component
- GO:0001917 photoreceptor inner segment
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005890 sodium:potassium-exchanging ATPase complex
- GO:0009897 external side of plasma membrane
- GO:0016020 membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0031253 cell projection membrane
- GO:0044298 cell body membrane
- GO:0071944 cell periphery
- GO:0097449 astrocyte projection
- GO:0097450 astrocyte end-foot
- GO:0098984 neuron to neuron synapse
Molecular Function
Biological Process
KEGG
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04260 Cardiac muscle contraction
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04960 Aldosterone-regulated sodium reabsorption
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04964 Proximal tubule bicarbonate reclamation
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04971 Gastric acid secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa04973 Carbohydrate digestion and absorption
- KEGG:hsa04974 Protein digestion and absorption
- KEGG:hsa04976 Bile secretion
- KEGG:hsa04978 Mineral absorption
Reactome
- R-hsa-210991 basigin interactions
- R-hsa-5576891 cardiac conduction
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-5578775 ion homeostasis
- R-hsa-936837 ion transport by p type atpases
- R-hsa-397014 muscle contraction
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9679506 sars cov infections
- R-hsa-382551 transport of small molecules
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
31 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| auxillarytransportunit | transporter | Surfaceome | No | Yes | No | Yes | No |
| transporter | transporter | OmniPath | No | Yes | No | Yes | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ARL6IP1ATP1B2FAM241ARABAC1RTN2RTN4SH3PXD2ATFAMTMT1B | O75298P14415Q00059Q15041Q5TCZ1Q6UX53Q8N8J7Q9NQC3Q9UI14 | 0:0:0:0:0:0:0:0:0 | hu.MAP | |||
| ATP1B2RTN4SH3PXD2ATFAM | P14415Q00059Q5TCZ1Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ARL6IP1ATP1B2RTN4SH3PXD2A | P14415Q15041Q5TCZ1Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ATP1B2RTN4SH3PXD2ATMT1B | P14415Q5TCZ1Q6UX53Q9NQC3 | 0:0:0:0 | hu.MAP | |||
| ATP1B2RABAC1RTN4SH3PXD2A | P14415Q5TCZ1Q9NQC3Q9UI14 | 0:0:0:0 | hu.MAP |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 37704453 |
Sequence, Structure & Domains
Sequences
Length
290
Mass
33,367
Sequence
MVIQKEKKSCGQVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQTVSDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
3D Structural Models
Domain & Motif Annotations
Domain (CC)
The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
Region
193..290; immunoglobulin-like
Protein Families
X(+)/potassium ATPases subunit beta family
Sequence Similarities
Belongs to the X(+)/potassium ATPases subunit beta family.