Protein detail
NCK1
SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)
Entry name NCK1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Predicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)
Protein Class
Predicted intracellular proteins
Protein Function
Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
NCKNCKalpha
Gene Description
NCK adaptor protein 1
Chromosome
3
Position
136862208-136951606
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificAstrocytesSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificT-reg
Function & Pathway
Protein Function
Predicted intracellular proteins
Cellular Component (9)
Molecular Function (13)
- GO:0004860 protein kinase inhibitor activity
- GO:0005102 signaling receptor binding
- GO:0005515 protein binding
- GO:0008093 cytoskeletal anchor activity
- GO:0019904 protein domain specific binding
- GO:0030159 signaling receptor complex adaptor activity
- GO:0030674 protein-macromolecule adaptor activity
- GO:0030971 receptor tyrosine kinase binding
- GO:0035591 signaling adaptor activity
- GO:0045296 cadherin binding
Page 1 of 2
KEGG (5)
Reactome (34)
- R-hsa-428540 activation of rac1
- R-hsa-1280218 adaptive immune system
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-1169410 antimicrobial mechanism of ifn stimulated genes
- R-hsa-1500931 cell cell communication
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-418885 dcc mediated attractive signaling
- R-hsa-186763 downstream signal transduction
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-202433 generation of second messenger molecules
Page 1 of 4
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence31
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| NCK1 | ABL1 | P00519 | Y | 105 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:22327338ProtMapper:22327338 |
| NCK1 | EGFR | P00533 | Y | 105 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:15951569 |
| NCK1 | EGF | P01133 | S | 85 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
| NCK1 | EGF | P01133 | S | 91 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:17081983 |
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | |||||
| intracellular | intracellular | GO_Intercell | |||||
| intracellular | intracellular | UniProt_location | |||||
| intracellular | intracellular | OmniPath |
Regulatory Interaction Network (15)
15 records.
Page 1 of 2Next
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster396 | NCK1NCK2PTPN1PTPN2 | O43639P16333P17706P18031 | 1:1:1:1 | Compleat | Compleat:HC1813 | 22036573 |
| Ternary complex (Abl1Dok1Nck1) | ABL1DOK1NCK1NCK2 | O43639P00519P16333Q99704 | 1:1:1:1 | Compleat | Compleat:HC417 | 15148308 |
| ALDH18A1HAT1HNRNPA1HNRNPRILF2KHDRBS1KHDRBS2KHDRBS3MOV10NCK1 | O14929O43390O75525P09651P16333P54886Q07666Q12905Q5VWX1Q9HCE1 | 1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5502 | ||
| HNRNPRKHDRBS1KHDRBS2KHDRBS3MOV10NCK1PRKAR1APUF60RRM1RRM2 | O43390O75525P10644P16333P23921P31350Q07666Q5VWX1Q9HCE1Q9UHX1 | 1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7020 | ||
| ALDH18A1HDAC6HNRNPRKHDRBS1KHDRBS2KHDRBS3MOV10MYD88NCK1PRMT1 | O43390O75525P16333P54886Q07666Q5VWX1Q99836Q99873Q9HCE1Q9UBN7 | 1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8528 | ||
| BRK1NCK1NCKAP1RAC1UBC | P0CG48P16333P63000Q8WUW1Q9Y2A7 | 1:1:1:1:1 | CompleatCFinder | Compleat:HC6109 | ||
| NCK1 | P16333 | 2 | PDB | PDB:5qu3PDB:5qu1PDB:5qu5PDB:5qu6PDB:5qu7PDB:5qu4PDB:5qua |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Size Exclusion Chromatography | Mass spectrometry | 1 | 28211531 |
Sequence, Structure & Domains
Sequences
Length
377
Mass
42,864
Sequence
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P16333-1; Sequence=Displayed; Name=2; IsoId=P16333-2; Sequence=VSP_043122
Alternative Sequence
1..76; MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLG -> MDWLNVFKDFFS (in isoform 2)
3D Structural Models
Helix
33..35; 53..55; 157..159; 289..299; 349..358
Beta Strand
5..8; 28..31; 38..42; 48..52; 56..58; 99..101; 109..115; 131..138; 142..148; 151..156; 160..162; 168..170; 304..309; 311..313; 316..321; 324..326; 328..335; 338..341; 344..348; 361..363
3D Structure
NMR spectroscopy (4); X-ray crystallography (11)
Domain & Motif Annotations
Domain (CC)
Only the first and third SH3 domains seem to be involved in RASA1-binding; the second SH3 domain and the SH2 domains do not seem to be involved.
Domain (FT)
2..61; SH3 1; 106..165; SH3 2; 190..252; SH3 3; 282..376; SH2
Clinical Relevance
Related Diseases
Biomarker
Phase 1
Drugs
Interaction Protein (23)
ENSG00000015285ENSG00000043462ENSG00000061938ENSG00000071051ENSG00000104814ENSG00000106069ENSG00000106299ENSG00000106976ENSG00000110395ENSG00000112079ENSG00000115904ENSG00000115935ENSG00000136754ENSG00000143322ENSG00000145715ENSG00000146648ENSG00000154310ENSG00000155629ENSG00000162522ENSG00000171475ENSG00000180370ENSG00000198851ENSG00000204131
Interaction Count
23
Interaction Dataset (3)
intact_biogridbiogrid_bioplexintact_biogrid_bioplex
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |