Protein detail

NCK1

SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)

Entry name NCK1	UniProt ID P16333	EVMP confidence score 0.38
Supporting publications (n) 1	Transmembrane count	Protein classification Predicted intracellular proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information11

Protein Names

SH2/SH3 adapter protein NCK1 (Cytoplasmic protein NCK1) (NCK adapter protein 1) (Nck-1) (SH2/SH3 adapter protein NCK-alpha)

Protein Class

Predicted intracellular proteins

Protein Function

Predicted intracellular proteins

Ensembl

ENSG00000158092

Entrez Gene Symbol

NCK1

Gene Synonym (2)

NCKNCKalpha

Gene Description

NCK adaptor protein 1

Chromosome

Position

136862208-136951606

Supporting publications (n)

EVMP confidence score

0.38

Fluorescence & Localization5

Tissue Specificblood vesselCell SpecificAstrocytesSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificT-reg

Function & Pathway6

Protein Function

Predicted intracellular proteins

Cellular Component (9)

Molecular Function (13)

Page 1 of 2

KEGG (5)

Reactome (34)

Page 1 of 4

Mediation Categories (5)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence31

Enzyme-Mediated Modification (4)

4 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
NCK1	ABL1	P00519	Y	105	phosphorylation	phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:22327338 ProtMapper:22327338
NCK1	EGFR	P00533	Y	105	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:15951569
NCK1	EGF	P01133	S	85	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:17081983
NCK1	EGF	P01133	S	91	phosphorylation	BEL-Large-Corpus_ProtMapperProtMapper	ProtMapper:17081983

Ligand-Receptor Signaling (4)

4 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
intracellular	intracellular	ComPPI	No	No	No	No	No
intracellular	intracellular	GO_Intercell	No	No	No	No	No
intracellular	intracellular	UniProt_location	No	No	No	No	No
intracellular	intracellular	OmniPath	No	No	No	No	No

Regulatory Interaction Network (15)

15 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
	COMPLEX:P04234_P07766_P09693_P20963	NCK1	P16333	Yes	Yes	No	SIGNOR	SIGNOR:12110186
CBLB	Q13191	NCK1	P16333	Yes	Yes	No	HPRDSPIKE_LCSIGNOR	SIGNOR:16503409 HPRD:16503409 SPIKE_LC:16189514
E2AK2	P19525	NCK1	P16333	Yes	No	Yes	SIGNOR	SIGNOR:18835251
CBL	P22681	NCK1	P16333	Yes	No	Yes	DOMINOSIGNORHPRDHINTIntActLi2012SPIKE_LCLit-BM-17	Lit-BM-17:9851874 DOMINO:7517397 HINT:7517397 HINT:24287595 Lit-BM-17:10967110 Lit-BM-17:10372803 HINT:10829062 HINT:10967110 Lit-BM-17:10204582 HPRD:7517397 IntAct:7517397 Lit-BM-17:10829062 Lit-BM-17:7517397 HINT:33961781 SPIKE_LC:7517397 Lit-BM-17:16503409 SIGNOR:24287595 Lit-BM-17:24287595 Lit-BM-17:11494134
NCK1	P16333	SOS1	Q07889	Yes	Yes	No	DOMINOWangNetPathSIGNORHPRDCui2007HINTIntActCancerCellMapSPIKE_LCLit-BM-17	HPRD:10206341 Lit-BM-17:17474147 SIGNOR:7862111 SPIKE_LC:17145710 HINT:10206341 HPRD:8810325 NetPath:10026169 Lit-BM-17:7862111 HPRD:10026169 HINT:7862111 CancerCellMap:10026169 Lit-BM-17:10026169 HPRD:7862111 SPIKE_LC:17474147 Lit-BM-17:10206341 HINT:33961781 HINT:8810325 IntAct:10206341 Lit-BM-17:8810325 IntAct:17474147 DOMINO:17474147

Page 2 of 2Previous

Protein Complex Composition (7)

7 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster396	NCK1 NCK2 PTPN1 PTPN2	O43639 P16333 P17706 P18031	1:1:1:1	Compleat	Compleat:HC1813	22036573
Ternary complex (Abl1Dok1Nck1)	ABL1 DOK1 NCK1 NCK2	O43639 P00519 P16333 Q99704	1:1:1:1	Compleat	Compleat:HC417	15148308
	ALDH18A1 HAT1 HNRNPA1 HNRNPR ILF2 KHDRBS1 KHDRBS2 KHDRBS3 MOV10 NCK1	O14929 O43390 O75525 P09651 P16333 P54886 Q07666 Q12905 Q5VWX1 Q9HCE1	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5502
	HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MOV10 NCK1 PRKAR1A PUF60 RRM1 RRM2	O43390 O75525 P10644 P16333 P23921 P31350 Q07666 Q5VWX1 Q9HCE1 Q9UHX1	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7020
	ALDH18A1 HDAC6 HNRNPR KHDRBS1 KHDRBS2 KHDRBS3 MOV10 MYD88 NCK1 PRMT1	O43390 O75525 P16333 P54886 Q07666 Q5VWX1 Q99836 Q99873 Q9HCE1 Q9UBN7	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8528
	BRK1 NCK1 NCKAP1 RAC1 UBC	P0CG48 P16333 P63000 Q8WUW1 Q9Y2A7	1:1:1:1:1	CompleatCFinder	Compleat:HC6109
	NCK1	P16333	2	PDB	PDB:5qu3PDB:5qu1PDB:5qu5PDB:5qu6PDB:5qu7PDB:5qu4PDB:5qua

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Size Exclusion Chromatography	Mass spectrometry	1	28211531

Sequence, Structure & Domains10

Sequences

Length

377

Mass

42,864

Sequence

MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAEREDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERGHEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAPIFTSEQGEKLYLVKHLS

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P16333-1; Sequence=Displayed; Name=2; IsoId=P16333-2; Sequence=VSP_043122

Alternative Sequence

1..76; MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKNSARKASIVKNLKDTLG -> MDWLNVFKDFFS (in isoform 2)

3D Structural Models

Helix

33..35; 53..55; 157..159; 289..299; 349..358

Beta Strand

5..8; 28..31; 38..42; 48..52; 56..58; 99..101; 109..115; 131..138; 142..148; 151..156; 160..162; 168..170; 304..309; 311..313; 316..321; 324..326; 328..335; 338..341; 344..348; 361..363

3D Structure

NMR spectroscopy (4); X-ray crystallography (11)

Domain & Motif Annotations

Domain (CC)

Only the first and third SH3 domains seem to be involved in RASA1-binding; the second SH3 domain and the SH2 domains do not seem to be involved.

Domain (FT)

2..61; SH3 1; 106..165; SH3 2; 190..252; SH3 3; 282..376; SH2

Clinical Relevance7

Related Diseases

Multiple sclerosis

Biomarker

Phase 1

Drugs

AX-024

Antibody (2)

CAB005063 HPA030766

Interaction Protein (23)

ENSG00000015285ENSG00000043462ENSG00000061938ENSG00000071051ENSG00000104814ENSG00000106069ENSG00000106299ENSG00000106976ENSG00000110395ENSG00000112079ENSG00000115904ENSG00000115935ENSG00000136754ENSG00000143322ENSG00000145715ENSG00000146648ENSG00000154310ENSG00000155629ENSG00000162522ENSG00000171475ENSG00000180370ENSG00000198851ENSG00000204131

Interaction Count

Interaction Dataset (3)

intact_biogridbiogrid_bioplexintact_biogrid_bioplex

Supporting Publications1

PMID	Title	Abstract
36146834	Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro.	No abstract available