Protein detail
DPEP1
Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
Entry name DPEP1 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 32 | Transmembrane count | Protein classification EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Dipeptidase 1 (EC 3.4.13.19) (Beta-lactamase) (EC 3.5.2.6) (Dehydropeptidase-I) (Microsomal dipeptidase) (Renal dipeptidase) (hRDP)
Protein Class (4)
EnzymesFDA approved drug targetsMetabolic proteinsPredicted intracellular proteins
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Hydrolases
Ensembl
Entrez Gene Symbol
Gene Description
Dipeptidase 1
Chromosome
16
Position
89613308-89638456
Supporting publications (n)
32
EVMP confidence score
0.88
Fluorescence & Localization
Tissue SpecificintestineBrain Regional Specificchoroid plexusCell SpecificColonocytesSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (4)
- Predicted intracellular proteins
- Enzymes
- FDA approved drug targets:Small molecule drugs
- ENZYME proteins:Hydrolases
Cellular Component (9)
Molecular Function (9)
- GO:0005515 protein binding
- GO:0008235 metalloexopeptidase activity
- GO:0008270 zinc ion binding
- GO:0008800 beta-lactamase activity
- GO:0016805 dipeptidase activity
- GO:0034235 GPI anchor binding
- GO:0043027 cysteine-type endopeptidase inhibitor activity involved in apoptotic process
- GO:0070573 metallodipeptidase activity
- GO:0072341 modified amino acid binding
Biological Process (3)
Reactome (10)
- R-hsa-5423646 aflatoxin activation and detoxification
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-2142753 arachidonate metabolism
- R-hsa-211859 biological oxidations
- R-hsa-8978868 fatty acid metabolism
- R-hsa-5663205 infectious disease
- R-hsa-9658195 leishmania infection
- R-hsa-9664535 ltc4 cysltr mediated il4 production
- R-hsa-556833 metabolism of lipids
- R-hsa-2142691 synthesis of leukotrienes lt and eoxins ex
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence34
Ligand-Receptor Signaling (30)
30 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | CellPhoneDB | Yes | Yes | |||
| transmembrane | transmembrane | TopDB | Yes | Yes | |||
| transmembrane | transmembrane | OmniPath | Yes | Yes | |||
| peripheral | peripheral | UniProt_location | Yes | Yes | |||
| peripheral | peripheral | OmniPath | Yes | Yes | |||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| apical_cell_membrane | plasma_membrane | UniProt_location | Yes | Yes | |||
| apical_cell_membrane | plasma_membrane | Ramilowski_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | Ramilowski_location | Yes | Yes | |||
| plasma_membrane | plasma_membrane | OmniPath | Yes | Yes |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| LeukotrieneE4_byDPEP1 | DPEP1 | P16444 | 2 | CellPhoneDBCellChatDBPDB | PDB:1itqPDB:1ituCellPhoneDB:LeukotrieneE4_byDPEP1 | |
| DPEP1SAYSD1STEAP2SUN1TBL2TMEM258TMUB2VMP1 | O94901P16444P61165Q71RG4Q8NFT2Q96GC9Q9NPB0Q9Y4P3 | 0:0:0:0:0:0:0:0 | hu.MAP2 | |||
| DPEP1SUN1TMUB2 | O94901P16444Q71RG4 | 0:0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
411
Mass
45,674
Sequence
MWSGWWLWPLVAVCTADFFRDEAERIMRDSPVIDGHNDLPWQLLDMFNNRLQDERANLTTLAGTHTNIPKLRAGFVGGQFWSVYTPCDTQNKDAVRRTLEQMDVVHRMCRMYPETFLYVTSSAGIRQAFREGKVASLIGVEGGHSIDSSLGVLRALYQLGMRYLTLTHSCNTPWADNWLVDTGDSEPQSQGLSPFGQRVVKELNRLGVLIDLAHVSVATMKATLQLSRAPVIFSHSSAYSVCASRRNVPDDVLRLVKQTDSLVMVNFYNNYISCTNKANLSQVADHLDHIKEVAGARAVGFGGDFDGVPRVPEGLEDVSKYPDLIAELLRRNWTEAEVKGALADNLLRVFEAVEQASNLTQAPEEEPIPLDQLGGSCRTHYGYSSGASSLHRHWGLLLASLAPLVLCLSLL
3D Structural Models
Turn
58..60; 90..93; 113..115; 181..183; 239..241; 305..307; 381..383
Helix
18..27; 39..47; 54..56; 68..73; 87..89; 94..111; 122..131; 143..146; 150..158; 178..180; 194..206; 217..226; 250..259; 269..272; 280..294; 296..298; 321..330; 335..342; 344..356; 370..372
Beta Strand
32..37; 63..65; 76..83; 116..118; 134..141; 161..166; 168..170; 173..175; 188..192; 209..211; 232..235; 262..265; 274..276; 299..301; 359..361; 375..377
3D Structure
X-ray crystallography (2)
Domain & Motif Annotations
Protein Families (2)
- Metallo-dependent hydrolases superfamily
- Peptidase M19 family
Sequence Similarities
Belongs to the metallo-dependent hydrolases superfamily. Peptidase M19 family.
Clinical Relevance
Disease Involvement
FDA approved drug targets
Related Diseases
Biomarker
Approved
Drug Targets
FDA approved drug targets
Drugs (12)
Interaction Protein
ENSG00000198954
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications32
| PMID | Title | Related sentences |
|---|---|---|
| 29562735 | Altered Proteome of Extracellular Vesicles Derived from Bladder Cancer Patients Urine. | No related sentences available |
| 30071318 | Changes in the urinary extracellular vesicle proteome are associated with nephronophthisis-related ciliopathies. | No related sentences available |
| 30608700 | Quantitative Proteomic Analysis of Small and Large Extracellular Vesicles (EVs) Reveals Enrichment of Adhesion Proteins in Small EVs. | No related sentences available |
| 30760538 | Microvesicle Proteomic Profiling of Uterine Liquid Biopsy for Ovarian Cancer Early Detection. | No related sentences available |
| 31508500 | Proteomic profiling of extracellular vesicles allows for human breast cancer subtyping. | No related sentences available |
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |
| 32927759 | Urinary Exosomes of Patients with Cystic Fibrosis Unravel CFTR-Related Renal Disease. | No related sentences available |
| 33580265 | Proteomic Profile of Urinary Extracellular Vesicles Identifies AGP1 as a Potential Biomarker of Primary Aldosteronism. | No related sentences available |
| 33729255 | A new urinary exosome enrichment method by a combination of ultrafiltration and TiO2 nanoparticles. | No related sentences available |
| 34131392 | Could protein content of Urinary Extracellular Vesicles be useful to detect Cirrhosis in Alcoholic Liver Disease? | No related sentences available |