Protein detail

EGLN

Endoglin (CD antigen CD105)

Protein symbol EGLN	UniProt ID P17813	EVMP score 0.50
Frequency 1	Transmembrane count 1	Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins

Basic Information

Protein Names

Endoglin (CD antigen CD105)

Protein Class

Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins

Protein Function

CD markers
Candidate cardiovascular disease genes
Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
Cancer-related genes:Candidate cancer biomarkers
Disease related genes

Transmembrane

587..611; Helical

Transmembrane Count

Ensembl

ENSG00000106991

Entrez Gene Symbol

ENG

Gene Synonym

CD105ENDHHT1ORWORW1

Gene Description

Endoglin

Chromosome

Position

127815013-127854658

Frequency

EVMP Score

0.50

Fluorescence & Localization

Cell SpecificEarly spermatids

Function & Pathway

Protein Function

CD markers
Candidate cardiovascular disease genes
Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
Cancer-related genes:Candidate cancer biomarkers
Disease related genes

Cellular Component

Molecular Function

Mediation Categories

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation

Relations & Evidence

Enzyme-Mediated Modification

10 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
ENG	SRC	P12931	Y	612	phosphorylation	PhosphoSite
ENG	SRC	P12931	Y	614	phosphorylation	PhosphoSite
ENG	TGFBR2	P37173	S	634	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	TGFBR2	P37173	S	635	phosphorylation	PhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper	ProtMapper:16785228
ENG	ACVRL1	P37023	S	646	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	ACVRL1	P37023	T	640	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	ACVRL1	P37023	T	654	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	ACVRL1	P37023	S	649	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	TGFBR1	P36897	S	646	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper
ENG	TGFBR1	P36897	S	649	phosphorylation	PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper

Ligand-Receptor Signaling

37 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	DGIdb	No	No	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	LOCATE	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
activating_cofactor	receptor_regulator	CellChatDB	Yes	No	No	Yes	No
receptor_regulator	receptor_regulator	OmniPath	Yes	No	No	Yes	No
growth_factor_binder	ligand_regulator	GO_Intercell	Yes	No	No	Yes	No
ligand_regulator	ligand_regulator	OmniPath	Yes	No	No	Yes	No
adhesion	adhesion	Adhesome	Yes	Yes	No	Yes	No

Page 1 of 4Next

Regulatory Interaction Network

4 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
EGLN	P17813	GDF2	Q9UK05	Yes	Yes	No	WangSIGNORIntAct	IntAct:28564608 SIGNOR:21737454
SRC	P12931	EGLN	P17813	Yes	No	Yes	PhosphoSite_norefSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper	SIGNOR:25070888 PhosphoSite:25070888
EGLN	P17813	BMP10	O95393	Yes	Yes	No	SIGNOR	SIGNOR:21737454
ACVL1	P37023	EGLN	P17813	Yes	No	No	PhosphoSite_MIMPMIMPPhosphoSite_norefiPTMnetProtMapperHINTInnateDBDIPWangPhosphoSitePhosphoSite_ProtMapper	HINT:16785228 PhosphoSite:16785228 HINT:23868260 PhosphoSite:20042635 HINT:28564608 InnateDB:18333754 HINT:10767348 HINT:18333754 InnateDB:16785228 DIP:10767348 DIP:23868260 InnateDB:15702480 HINT:15702480

Protein Complex Composition

14 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
DSS1 complex	BRCA2 INTS10 INTS11 INTS2 INTS4 INTS5 INTS6 INTS7 INTS8 INTS9 LENG8 SAC3D1 SEM1	A6NKF1 P51587 P60896 Q5TA45 Q6P9B9 Q75QN2 Q96HW7 Q96PV6 Q9H0H0 Q9NV88 Q9NVH2 Q9NVR2 Q9UL03	0:0:0:0:0:0:0:0:0:0:0:0:0	CORUM	CORUM:1154	16239144
DSS1 complex	BRCA2 INTS10 INTS11 INTS2 INTS4 INTS5 INTS6 INTS7 INTS8 INTS9 LENG8 SEM1	P51587 P60896 Q5TA45 Q6P9B9 Q75QN2 Q96HW7 Q96PV6 Q9H0H0 Q9NV88 Q9NVH2 Q9NVR2 Q9UL03	1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC2048	16239144
Endoglin homodimer complex	ENG	P17813	0	CORUM	CORUM:1986	15806144
	DUT ENG MRPL14 MRPL22 MRPS10 MRPS11 MRPS14 PHB2 TUFM	O60783 P17813 P33316 P49411 P82664 P82912 Q6P1L8 Q99623 Q9NWU5	0:0:0:0:0:0:0:0:0	Havugimana2012	Havugimana2012:C_573
	CARNMT1 LENG9 NR3C2 ZBTB25	P08235 P24278 Q8N4J0 Q96B70	0:0:0:0	hu.MAP
	CARNMT1 LENG9 NR3C2 SARM1	P08235 Q6SZW1 Q8N4J0 Q96B70	0:0:0:0	hu.MAP
	CARNMT1 LENG9 MKRN2 NR3C2	P08235 Q8N4J0 Q96B70 Q9H000	0:0:0:0	hu.MAP
	CARNMT1 CNTLN LENG9 NR3C2	P08235 Q8N4J0 Q96B70 Q9NXG0	0:0:0:0	hu.MAP
	CARNMT1 LENG9 NR3C2 TAB2	P08235 Q8N4J0 Q96B70 Q9NYJ8	0:0:0:0	hu.MAP
	CARNMT1 DTL LENG9 NR3C2	P08235 Q8N4J0 Q96B70 Q9NZJ0	0:0:0:0	hu.MAP

Page 1 of 2Next

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential Ultracentrifugation	ELISA	3	37322475 41307968 38207106

Sequence, Structure & Domains

Sequences

Length

658

Mass

70,578

Sequence

MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA

Alternative Products

Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=P17813-1; Sequence=Displayed; Name=Short; IsoId=P17813-2; Sequence=VSP_004233

Alternative Sequence

619..658; SPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA -> EYPRPPQ (in isoform Short)

3D Structural Models

Turn

37..39; 122..124; 445..447; 499..501

Helix

143..151; 296..305; 352..358; 374..379; 560..562

Beta Strand

40..54; 61..70; 76..83; 94..103; 105..111; 116..120; 125..129; 132..137; 156..171; 185..189; 193..200; 205..208; 217..224; 232..240; 249..254; 259..267; 270..279; 309..327; 360..363; 365..373; 384..388; 400..408; 415..417; 420..431; 436..443; 448..459; 465..467; 473..481; 484..496; 503..508; 517..519; 524..526; 529..532; 538..540; 543..555; 564..574

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Compositional Bias

626..639; Low complexity; 640..658; Polar residues

Motif

399..401; Cell attachment site

Domain (CC)

The ZP domain mediates dimerization.; DOMAIN: The N-terminal OR region is composed of two intertwined domains (OR1 and OR2) with a common, novel fold. Each contains 12 beta-strands that form a parallel beta-helix-like structure, plus a single alpha-helix. The OR1 region mediates interaction with GDF2..

Domain (FT)

363..533; ZP

Region

26..337; Required for interaction with GDF2; 26..46; OR1, N-terminal part; 47..199; OR2; 200..330; OR1, C-terminal part; 270..282; Essential for interaction with GDF2; 626..658; Disordered

Clinical Relevance

Disease Involvement

Cancer-related genesDisease variant

Related Diseases

Angiosarcoma Brain cancer Breast cancer Fallopian tube cancer Gynecologic cancer Kaposi sarcoma Liver cancer Lung cancer Non-small-cell lung cancer Ovarian cancer Peritoneal cancer Renal cell carcinoma Retinopathy

Biomarker

Phase 3; Phase 2; Phase 1

Drugs

CAROTUXIMAB DS21360717 METHOTREXATE RO3280 COMPOUND 25B [PMID: 22564207]COMPOUND 8E [PMID: 24432909]

Antibody

CAB000096 HPA011862 HPA067440 CAB072873

Interaction Protein

ENSG00000131981ENSG00000132109

Interaction Count

Interaction Dataset

intact_biogrid