Protein detail
EGLN
Endoglin (CD antigen CD105)
Entry name EGLN | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Endoglin (CD antigen CD105)
Protein Class (7)
Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesHuman disease related genesPlasma proteinsPredicted membrane proteins
Protein Function (5)
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Transmembrane
587..611; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD105ENDHHT1ORWORW1
Gene Description
Endoglin
Chromosome
9
Position
127815013-127854658
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Cell SpecificEarly spermatids
Function & Pathway
Protein Function (5)
- CD markers
- Candidate cardiovascular disease genes
- Human disease related genes:Congenital malformations:Congenital malformations of the circulatory system
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
Cellular Component (8)
Molecular Function (14)
- GO:0004888 transmembrane signaling receptor activity
- GO:0005024 transforming growth factor beta receptor activity
- GO:0005114 type II transforming growth factor beta receptor binding
- GO:0005515 protein binding
- GO:0005534 galactose binding
- GO:0005539 glycosaminoglycan binding
- GO:0015026 coreceptor activity
- GO:0030546 signaling receptor activator activity
- GO:0034713 type I transforming growth factor beta receptor binding
- GO:0036122 BMP binding
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence66
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ENG | SRC | P12931 | Y | 612 | phosphorylation | PhosphoSite | |
| ENG | SRC | P12931 | Y | 614 | phosphorylation | PhosphoSite | |
| ENG | TGFBR2 | P37173 | S | 634 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | TGFBR2 | P37173 | S | 635 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperRLIMS-P_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:16785228 |
| ENG | ACVRL1 | P37023 | S | 646 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | ACVRL1 | P37023 | T | 640 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | ACVRL1 | P37023 | T | 654 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | ACVRL1 | P37023 | S | 649 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | TGFBR1 | P36897 | S | 646 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ENG | TGFBR1 | P36897 | S | 649 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (37)
37 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| matrix_adhesion | matrix_adhesion | Cellinker | Yes | Yes | |||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| matrix_adhesion | matrix_adhesion | OmniPath | Yes | Yes | |||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes |
Regulatory Interaction Network (4)
4 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| EGLN | P17813 | GDF2 | Q9UK05 | Yes | Yes | WangSIGNORIntAct | IntAct:28564608SIGNOR:21737454 | |
| SRC | P12931 | EGLN | P17813 | Yes | Yes | PhosphoSite_norefSIGNORProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:25070888PhosphoSite:25070888 | |
| EGLN | P17813 | BMP10 | O95393 | Yes | Yes | SIGNOR | SIGNOR:21737454 | |
| ACVL1 | P37023 | EGLN | P17813 | Yes | PhosphoSite_MIMPMIMPPhosphoSite_norefiPTMnetProtMapperHINTInnateDBDIPWangPhosphoSitePhosphoSite_ProtMapper | HINT:16785228PhosphoSite:16785228HINT:23868260PhosphoSite:20042635HINT:28564608InnateDB:18333754HINT:10767348HINT:18333754InnateDB:16785228DIP:10767348DIP:23868260InnateDB:15702480HINT:15702480 |
Protein Complex Composition (14)
14 records.
Page 1 of 2Next
Sequence, Structure & Domains
Sequences
Length
658
Mass
70,578
Sequence
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASMISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=Long; IsoId=P17813-1; Sequence=Displayed; Name=Short; IsoId=P17813-2; Sequence=VSP_004233
Alternative Sequence
619..658; SPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA -> EYPRPPQ (in isoform Short)
3D Structural Models
Turn
37..39; 122..124; 445..447; 499..501
Helix
143..151; 296..305; 352..358; 374..379; 560..562
Beta Strand
40..54; 61..70; 76..83; 94..103; 105..111; 116..120; 125..129; 132..137; 156..171; 185..189; 193..200; 205..208; 217..224; 232..240; 249..254; 259..267; 270..279; 309..327; 360..363; 365..373; 384..388; 400..408; 415..417; 420..431; 436..443; 448..459; 465..467; 473..481; 484..496; 503..508; 517..519; 524..526; 529..532; 538..540; 543..555; 564..574
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Compositional Bias
626..639; Low complexity; 640..658; Polar residues
Motif
399..401; Cell attachment site
Domain (CC)
The ZP domain mediates dimerization.; DOMAIN: The N-terminal OR region is composed of two intertwined domains (OR1 and OR2) with a common, novel fold. Each contains 12 beta-strands that form a parallel beta-helix-like structure, plus a single alpha-helix. The OR1 region mediates interaction with GDF2..
Domain (FT)
363..533; ZP
Region
26..337; Required for interaction with GDF2; 26..46; OR1, N-terminal part; 47..199; OR2; 200..330; OR1, C-terminal part; 270..282; Essential for interaction with GDF2; 626..658; Disordered
Clinical Relevance
Disease Involvement (2)
Cancer-related genesDisease variant
Related Diseases (13)
Biomarker
Phase 3; Phase 2; Phase 1
Drugs (6)
Interaction Protein (2)
ENSG00000131981ENSG00000132109
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 36146834 | Human Cytomegalovirus Modifies Placental Small Extracellular Vesicle Composition to Enhance Infection of Fetal Neural Cells In Vitro. | No related sentences available |