Protein detail

TSN8

Tetraspanin-8 (Tspan-8) (Transmembrane 4 superfamily member 3) (Tumor-associated antigen CO-029)

Entry name TSN8	UniProt ID P19075	EVMP confidence score 0.47
Supporting publications (n) 14	Transmembrane count 4	Protein classification Cancer-related genesPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Tetraspanin-8 (Tspan-8) (Transmembrane 4 superfamily member 3) (Tumor-associated antigen CO-029)

Protein Class (2)

Cancer-related genesPredicted membrane proteins

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Transmembrane

10..33; Helical; 58..72; Helical; 84..109; Helical; 206..230; Helical

Transmembrane Count

Ensembl

ENSG00000127324

Entrez Gene Symbol

TSPAN8

Gene Synonym (2)

CO-029TM4SF3

Gene Description

Tetraspanin 8

Chromosome

Position

71125085-71441898

Supporting publications (n)

EVMP confidence score

0.47

Fluorescence & Localization5

Tissue SpecificbreastCell SpecificBreast secretory cellsSingle-Nuclei Brain Specificcerebellar inhibitoryBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes

Function & Pathway5

Protein Function

Cancer-related genes:Candidate cancer biomarkers

Cellular Component (3)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Immune mediation

Relations & Evidence21

Ligand-Receptor Signaling (20)

20 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
transmembrane	transmembrane	Ramilowski_location	No	No	No	Yes	No
transmembrane	transmembrane	OmniPath	No	No	No	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	No	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	No	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	No	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	No	Yes	No
cell_surface	cell_surface	OmniPath	No	No	No	Yes	No
receptor	receptor	CellCellInteractions	No	Yes	No	Yes	No
transmembrane	transmembrane_predicted	Phobius	No	No	No	Yes	No

Page 2 of 2Previous

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion ChromatographyImmunoaffinity Capture	Mass spectrometry	4	38113368 41068253 40730843 32230970

Sequence, Structure & Domains5

Sequences

Length

237

Mass

26,044

Sequence

MAGVSACIKYSMFTFNFLFWLCGILILALAIWVRVSNDSQAIFGSEDVGSSSYVAVDILIAVGAIIMILGFLGCCGAIKESRCMLLLFFIGLLLILLLQVATGILGAVFKSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKNLIIVIGISFGLAVIEILGLVFSMVLYCQIGNK

Domain & Motif Annotations

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance5

Disease Involvement

Cancer-related genes

Antibody (3)

HPA022273 CAB026009 HPA044337

Interaction Protein

ENSG00000141434

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications14

PMID	Title	Abstract
32195353	Extracellular vesicle tetraspanin-8 level predicts distant metastasis in non-small cell lung cancer after concurrent chemoradiation.	We used proteomics to identify proteins differentially expressed on extracellular vesicles (EVs) of nonmetastatic 393P and metastatic 344SQ NSCLC cell lines and found that tetraspanin-8 (Tspan8) was selectively enriched on 344SQ EVs.
33773551	Exosomal Protease Cargo as Prognostic Biomarker in Colorectal Cancer.	Protease cargo in CD9-positive blood plasma exosomes is prognostic biomarker for colorectal polyps and colorectal cancer. The levels of 20S proteasomes and ADAM10+/ADAM17- subpopulations in CD9-positive blood plasma exosomes are the most significant values for predicting relapse-free survival. The levels of 20S proteasomes in exosomes, MMP9+, MMP9+/MMP2+/EMMPRIN+ in CD9-positive blood plasma exosomes are associated with the risk of malignant transformation of colorectal tubulovillous adenomas. The subpopulations of CD151- and Tspan8-positive exosomes, the subpopulations of metalloproteinase at the surface of СD9-positive exosomes and the level of 20S proteasomes in plasma exosomes in 15 CPPs (tubulovillous adenomas) and 60 CRCPs were evaluated using flow cytometry and Western blotting.
36613908	Comparative Analysis of Tumor-Associated microRNAs and Tetraspanines from Exosomes of Plasma and Ascitic Fluids of Ovarian Cancer Patients.	CD151- and Tspan8-positive exosomes are known to support the degradation of the extracellular matrix, and are involved in stroma remodeling, angiogenesis and cell motility, as well as the association of miR-24 and miR-101 with these processes.
38139054	Lung Cancer Cell-Derived Exosome Detection Using Electrochemical Approach towards Early Cancer Screening.	The cell-derived exosomes were successfully immobilized on the FTO electrode through the CD-151 antibody, and cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS) methods were used in this research.

Page 2 of 2Previous