Protein detail
ELAF
Elafin (Elastase-specific inhibitor) (ESI) (Peptidase inhibitor 3) (PI-3) (Protease inhibitor WAP3) (Skin-derived antileukoproteinase) (SKALP) (WAP four-disulfide core domain protein 14)
Entry name ELAF | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 20 | Transmembrane count | Protein classification Plasma proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Elafin (Elastase-specific inhibitor) (ESI) (Peptidase inhibitor 3) (PI-3) (Protease inhibitor WAP3) (Skin-derived antileukoproteinase) (SKALP) (WAP four-disulfide core domain protein 14)
Protein Class (2)
Plasma proteinsPredicted secreted proteins
Protein Function
Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
cementoinELAFINESISKALPWAP3WFDC14
Gene Description
Peptidase inhibitor 3
Chromosome
20
Position
45174902-45176544
Supporting publications (n)
20
EVMP confidence score
0.60
Fluorescence & Localization
Tissue Specificskeletal muscleCell SpecificBergmann glia
Function & Pathway
Protein Function
Predicted secreted proteins
Cellular Component (5)
Molecular Function (3)
Biological Process (3)
Reactome (4)
Mediation Categories
Immune mediation
Relations & Evidence23
Ligand-Receptor Signaling (19)
19 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted_peptidase_inhibitor | secreted_peptidase_inhibitor | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes | ||||
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | OmniPath | Yes | ||||
| ligand | ligand | iTALK | Yes | Yes | |||
| ligand | ligand | CellTalkDB | Yes | Yes | |||
| ligand | ligand | Guide2Pharma | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes |
Page 2 of 2Previous
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CSTADSPEVPLIVLKRT1KRT5LORICRINPI3SPRR3 | P01040P04264P07476P13647P15924P19957P23490Q92817Q9UBC9 | 1:1:1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC7996 | ||
| CSTADSPEVPLIVLKRT1LORICRINPI3 | P01040P04264P07476P15924P19957P23490Q92817 | 1:1:1:1:1:1:1 | CompleatCFinder | Compleat:HC6364 | ||
| PI3 | P19957 | 18 | PDB | PDB:6atu |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography | Mass spectrometry | 1 | 38576002 |
Sequence, Structure & Domains
Sequences
Length
117
Mass
12,270
Sequence
MRASSFLIVVVFLIAGTLVLEAAVTGVPVKGQDTVKGRVPFNGQDPVKGQVSVKGQDKVKAQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ
3D Structural Models
Helix
95..97
Beta Strand
65..69; 73..75; 81..84; 98..101; 103..106; 108..114
3D Structure
NMR spectroscopy (1); X-ray crystallography (2)
Domain & Motif Annotations
Repeat
29..54; SVP-1 clotting 1; 55..72; SVP-1 clotting 2
Domain (CC)
Consists of two domains: the transglutaminase substrate domain (cementoin moiety) and the elastase inhibitor domain. The transglutaminase substrate domain serves as an anchor to localize elafin covalently to specific sites on extracellular matrix proteins.
Domain (FT)
69..117; WAP
Region
29..72; 2 X tandem repeats of SVP-1 like motif
Clinical Relevance
Drugs
Supporting Publications20
| PMID | Title | Related sentences |
|---|---|---|
| 38490958 | Proteomic analysis of ascitic extracellular vesicles describes tumour microenvironment and predicts patient survival in ovarian cancer. | No related sentences available |
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No related sentences available |
| 39104279 | A Predictive Model for Initial Platinum-Based Chemotherapy Efficacy in Patients with Postoperative Epithelial Ovarian Cancer Using Tissue-Derived Small Extracellular Vesicles. | No related sentences available |
| 39290459 | Urinary extracellular vesicles as a monitoring tool for renal damage in patients not meeting criteria for chronic kidney disease. | No related sentences available |
| 39835386 | Comparison of nanoLC-MALDI-MS/MS with nanoLC-TIMS-MS/MS in the proteomic analysis of extracellular vesicles of bronchoalveolar lavage fluid. | No related sentences available |
| 39873726 | Size-Dependent Separation of Extracellular Vesicle Subtypes with Exodisc Enabling Proteomic Analysis in Prostate Cancer. | No related sentences available |
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No related sentences available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No related sentences available |
Page 2 of 2Previous